KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_07660Help
Entry
APA42C_07660      CDS       T01818                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
apw00020  Citrate cycle (TCA cycle)
apw00310  Lysine degradation
apw00380  Tryptophan metabolism
apw01100  Metabolic pathways
apw01110  Biosynthesis of secondary metabolites
apw01120  Microbial metabolism in diverse environments
apw01130  Biosynthesis of antibiotics
apw01200  Carbon metabolism
Module
apw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APA42C_07660
  09105 Amino acid metabolism
   00310 Lysine degradation
    APA42C_07660
   00380 Tryptophan metabolism
    APA42C_07660
Enzymes [BR:apw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     APA42C_07660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: BAI17202
LinkDB All DBs
Position
795227..798241
Genome map
AA seq 1004 aa AA seqDB search
MAFRQKGHRGRSALWGGVKKKWSGLRWRTTQYLANGAYVPRGKEECEMAVSDVLATALNG
ANIAYLADLYAQWAKDPKSVDPSFDILFSSLGDDEAAVLKDAVGASWAPRPSIITGDEPA
PAPKGKGGPAGGLAAQDSLAIARLIRAYREYGHLEASLDPLGLKVPHKTEELDPATYGFG
EKDLNREVFIGSLLDPLLKGKNTAKVSEVIAALRSVYCESIGAEYMYARNHEQREWLRKR
LEGDNWRAHVTVEEQKVILANLTEAEGFEAFCQKRYVGAKRFGLEGGEISIPSLHAIIDS
CASQGVTSVAIGMAHRGRLNTLVNVVRKPYVAIFNEFAGGSFKPDNVEGSGDVKYHLGSS
TDVDVAGKAVHISLQPNPSHLEAVDPVVCGKVRAIQDDAGDTEKRLSSLGVIIHGDAAFA
GQGIVYETFAMSQLPGYRTGGTIHMVVNNQIGFTTNPECGHSGIYGTDVAKSIEAPVLHV
NGDDAEAVIYVSRLAADYRQAFASDIVLDIVCYRRHGHNETDEPVFTQPVMYKAIAAHDT
PHTLYAKRLVKAGVVTDDEVKAQWDAFHAKLDEDYKAAQSYKVNKADWLEGGWKGLVAAG
HDPERAFPETGVALDALRKIGEAITKVPEGFNLNSKIARQLKAKANMFSTGEGFDWATGE
ALGFGSLLLDGHRVRLSGEDCQRGTFSQRHAVWTDQVNQTPFTPLNHIQDKQAKIEIWNS
LLSEYGVVGFEYGYSVRNPQTLVLWEAQFGDFANCAQVIIDQFIASGETKWLRMSGLVML
LPHGYEGQGPEHSSARLERYLQLCAENNMFVCNITTPANYFHALRRQLKLDYRKPMILME
PKSLLRHKLAVSALADFGPGTRFKPVIGEIDDLGADNKVRRVVICSGKVYYDLLAERREK
GIKDVAILRLEQLYPFPEAALAAELKRYSEADIVWCQEETENGGAWHFADRRIEAALAAA
GHKAGRPQYVGRAAAASPATGLARIHAAEQADLVERALGLKKSG
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atggctttccggcaaaaaggacacaggggacgctccgcgctatggggcggagtgaagaaa
aaatggtccggtttacggtggagaacgacgcaatatctggccaacggcgcgtatgtgccc
cgtggcaaggaggaatgtgagatggcggtttcggacgtactggcaaccgctcttaacggt
gccaatatcgcttaccttgcggatctgtatgcccagtgggcgaaggatcccaaaagtgtg
gatccgtccttcgatattctgttcagctcattgggcgatgatgaagccgcagtgctgaag
gatgccgttggagcctcttgggcgccacgcccttccattatcacgggggatgaacccgca
cctgctccgaaaggaaaaggtggcccggctggtgggttggccgcgcaggatagtctggcc
attgcccggctgatccgtgcgtatcgtgaatacggccacctggaagcctcgcttgatccg
ctgggcctgaaggtgcctcataaaaccgaggaactggaccccgccacatacggttttggt
gaaaaagacctgaaccgcgaagtgtttattgggtcactgcttgatccgctgctcaagggc
aagaacacggccaaggtttccgaggttattgcggcactccgctctgtgtattgcgaaagc
attggcgcagaatacatgtatgcccgtaaccacgaacagcgcgaatggctgcgcaagcgg
ctggaaggcgataactggcgcgcccacgtaacagtggaagagcagaaggttatcttggcc
aacctgacagaagccgaaggttttgaggctttctgccagaagcgctatgtgggtgcgaag
cgttttggtctggaagggggcgaaatctccattccttccctgcacgccattattgattcc
tgtgccagccagggggtgacatctgttgccatcggcatggcgcatcgtggccgcttgaac
acgctggttaacgtggtgcgcaagccttacgtggccatctttaacgaatttgcaggtggt
tccttcaaaccagacaatgttgaaggttctggcgacgttaaataccaccttggctcctcc
acagatgtggatgtggcaggcaaggcggtgcatatctcgctccagcccaacccttctcat
ctggaagcagtggatccggttgtgtgcggcaaggtgcgcgccattcaggatgatgcgggc
gatacggaaaaacgcctgtccagccttggcgttatcatccacggtgatgccgcgtttgcc
gggcagggcattgtttacgaaaccttcgccatgtcccaactgccgggctaccgcacgggt
ggcaccatccatatggtagtgaacaaccagattggctttaccaccaatccggaatgtggg
cattcaggcatttatggcaccgatgttgcaaaatccattgaagcccctgtgctgcatgta
aacggtgatgatgccgaggcggtgatttatgtctctcgccttgctgcggattaccgtcag
gcttttgcaagtgacattgtgctggatatcgtttgctaccgtcgccacgggcataacgaa
acggatgagccagttttcactcagcccgtcatgtataaagctattgccgcgcatgatacg
ccgcacacgctttatgcaaaacgccttgtaaaagcaggcgttgtgacggatgacgaagtg
aaggcccagtgggatgctttccacgccaagctggatgaagattacaaagctgcccagtct
tacaaggtgaacaaggcagactggctggaaggtggctggaaaggcctggtggctgccggg
catgatccggaacgcgccttccccgaaaccggtgttgcactggatgcgctgcgcaagatt
ggcgaagccattacaaaagtgccagaaggcttcaacctgaattccaaaattgcccgccag
ctcaaggccaaggcaaacatgttcagcacgggtgaagggtttgactgggcaaccggtgag
gctctgggctttggctccctgttgctggatggccaccgtgtgcgtctttccggtgaagat
tgccagcgtggcacgttcagccagcgtcatgccgtatggacggaccaggttaaccagaca
ccgtttacgccgctgaaccatattcaggacaagcaggcgaaaatcgaaatctggaactcg
cttctttcagaatacggcgtggttgggtttgaatacggatattccgtgcgcaacccacaa
acgctggtgctgtgggaagcccagtttggtgattttgccaactgtgctcaggtaattatc
gatcagttcatcgcctcgggtgaaaccaagtggttgcgtatgtccggtttggtcatgctg
ctgccgcatggttacgaagggcaggggccggaacattcttctgctcgtctggaacgttat
cttcagctttgtgctgaaaataacatgtttgtttgcaacatcaccacgcccgcaaactac
ttccacgccctgcgccgccagctcaagctggattaccgcaagccgatgatcctgatggag
cccaagtctctgctgcggcacaaacttgcggtttccgctctggcagattttggtccgggc
acacgctttaaacccgtgattggcgaaattgatgatctgggcgccgataacaaggtgcgc
cgcgtggtgatctgttctggcaaggtctattatgatctgctggccgaacgccgggaaaaa
ggcatcaaggatgttgccatcctgcgtctggaacaactctaccccttcccggaagcagcc
cttgccgccgaacttaagcgctattctgaagcagacattgtctggtgtcaggaagaaacg
gaaaacggcggtgcatggcattttgcagacaggcggattgaagcagcccttgctgccgca
ggccataaggcaggccgcccgcaatatgtgggccgcgccgcagcagccagcccggccacc
ggccttgcccgtattcatgcggcagagcaggcggatctggttgaacgcgcattggggctg
aaaaagtctggctga

DBGET integrated database retrieval system