KEGG   Acetobacter pasteurianus IFO 3283-01-42C: APA42C_24990Help
Entry
APA42C_24990      CDS       T01818                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
apw  Acetobacter pasteurianus IFO 3283-01-42C
Pathway
apw00473  D-Alanine metabolism
apw01100  Metabolic pathways
apw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:apw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    APA42C_24990
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    APA42C_24990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apw01011]
    APA42C_24990
Enzymes [BR:apw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     APA42C_24990
Peptidoglycan biosynthesis and degradation proteins [BR:apw01011]
 Precursor biosynthesis
  Racemase
   APA42C_24990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAI18826
LinkDB All DBs
Position
complement(2614859..2616004)
Genome map
AA seq 381 aa AA seqDB search
MAVVNTVSSSARTLWPASRAGAVLTVNLSAIAENYRYLKSRLGKTACAAVVKADAYGLGV
AQVAPVLEKAGAEHFFVAHVDEGLALRPFLSPHTSVTVLHGPRPDAAEVCVRNNLRPVLN
SLEQVAVLRDLAAKMDKPLDVAIQLDTGMSRFGLSEADIHKLVASPELLKGLFVSLVMSH
LACADTPQNPANTMQRERFEAYARILPQAALSLSASSGIFLGPQFHFDLVRPGAALYGVA
PQNEGDNPLKPVVGLQAHILQIRHLSKGDRVGYGLTWQAHGPCRVATIATGYADGFARAG
AAAGCAWYKGYRLPILGRISMDSMTVDLSAVPEGLLEEDSMVELLNESYGVDAVAKAEGT
IGYEVLTSLGRRYHRVYAAAA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtggcggttgtgaatactgtttcgtcctcagccagaacattgtggccggcatctcgcgcg
ggggctgttcttacagtcaacctgtctgccattgctgaaaattaccgctatcttaaaagc
cgactaggcaaaacagcgtgtgccgcagtggttaaggcggatgcctatgggctgggtgtt
gcgcaggtggcgcctgttttggaaaaagcaggtgcagaacatttttttgttgcgcatgta
gatgaaggacttgccctcaggccatttctctctcctcacacatcggtaacagtgttgcat
gggcctaggcctgatgctgctgaggtatgtgtacgcaacaatctgcggcctgttctgaac
agtttggaacaagttgctgttttgcgagatctggcagccaaaatggataagcctctggat
gtggctattcagcttgatacgggcatgtctcgttttgggctttcagaggcggatattcat
aaactggtggcgtctccagagcttctgaaaggcttatttgtcagtctggtgatgagtcat
ctggcgtgcgcagatacaccgcaaaatccagcaaacaccatgcagcgcgaacggtttgag
gcatatgcccgcatactgccgcaagcggcattaagcctttctgcatcatccggcattttt
ctggggccacagtttcattttgacctcgtgcgccccggagctgctttatatggcgtggca
ccacagaatgagggtgataacccgctcaagcctgtggttggcctgcaagcgcatattctg
caaattcgtcatttatccaagggagaccgggtcggttacgggttgacatggcaggctcat
ggtccatgccgtgttgccactattgctaccggttatgcagatggttttgcccgtgccggg
gctgccgctgggtgcgcttggtataagggctatcggctgccaattctgggccgaatttcc
atggattccatgactgttgatctttctgcagtgcccgagggtctgttggaagaagacagc
atggtggaacttctgaatgagtcgtacggcgtagatgctgtggccaaagcagaaggcaca
attggctacgaagtactgacatctctggggcggcgttatcatcgcgtttacgcagcggct
gcctga

DBGET integrated database retrieval system