KEGG   Anaplasma phagocytophilum HZ2: YYU_00775Help
Entry
YYU_00775         CDS       T02753                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
apy  Anaplasma phagocytophilum HZ2
Pathway
apy00020  Citrate cycle (TCA cycle)
apy00190  Oxidative phosphorylation
apy00650  Butanoate metabolism
apy01100  Metabolic pathways
apy01110  Biosynthesis of secondary metabolites
apy01120  Microbial metabolism in diverse environments
apy01130  Biosynthesis of antibiotics
apy01200  Carbon metabolism
Module
apy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
apy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:apy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YYU_00775
   00650 Butanoate metabolism
    YYU_00775
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YYU_00775
Enzymes [BR:apy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     YYU_00775
    1.3.5.4  fumarate reductase (quinol)
     YYU_00775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 Lycopene_cycl FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGR78632
LinkDB All DBs
Position
159802..161616
Genome map
AA seq 604 aa AA seqDB search
MIEVSRSAYEVVDHEYDVVVVGAGGAGLRAVVGMTAAGLSVACVTKVFPTRSHTVAAQGG
ISAALGNIAEDDWRWHMFDTVKGSDWLGDQDAIEYMCKNAMQSVVELEHCGVPFSRTKEG
KIYQRPFGGMTTEYGKGKPAVRTCAASDKTGHAILHALYQQSLRFDAKFFVEYFAIDLIM
SEDNRSCCGVLAWSLCDGVLHRFRAHAVVLATGGYGRVYFSATSAHTCTGDGGGMAARAG
IPLEDMEFVQFHPTGIYGSGCLMTEGCRGEGGYLLNSAGERFMERYAPKAKDLASRDVVS
RSMTMEIREGRGVGEKKDHIYLSIAHLDPKVIHERLPGISETAKTFAGVDVTKEPIPVIP
TVHYNMGGIPTNYHGEVLSLNSSSGSYEVVEGLFAIGEAACVSVHGANRLGSNSLLDLVV
FGRAAAIRAKEVIKPGGLHRPIRKDFEDSIIDRFDRMRYANGATRVAEIRSRMQNVMQEH
AAVFRVAEVLEKGKKEIRGVAAMMKDISVTDRSMVWNSDLVEALELSNMMPQAVVTVDCA
ANRKESRGAHAREDFPERDDENWMKHTMAWCNCDTYEVKIGYKEVATYTLTNEVEYFPPQ
KRVY
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaagtgtctagatccgcatacgaagttgtggaccatgagtatgacgtggttgtt
gttggtgcgggtggtgcaggattgcgcgctgtagtgggtatgacggcagcgggtctttcg
gttgcgtgcgttactaaagtatttccaacacggagccacactgttgctgcacaaggtggt
attagcgctgcgttgggtaatatagcagaagatgattggcgatggcacatgttcgataca
gtcaagggttctgattggctaggtgatcaggatgcgattgagtacatgtgtaagaatgct
atgcagtccgttgtggagcttgagcattgtggagtgcctttctctagaactaaggaaggt
aagatatatcagcgtccttttggtgggatgacaactgaatacggcaagggtaagcctgca
gtacgtacatgtgctgcatcagataaaacaggacatgctatattgcatgctttgtatcag
cagtctttgaggtttgatgcgaagtttttcgtcgagtacttcgcaatagacttgataatg
agtgaagataatcggtcatgttgtggggtgttggcatggtctttgtgcgatggtgtttta
catagatttcgtgctcatgcagtagttttagctactggtgggtatgggcgtgtatatttt
tctgcaactagcgcacatacatgtactggagatggtggtggaatggcggcaagggctggt
attccgcttgaggatatggaatttgtgcaatttcaccctacgggcatatatggttctggg
tgcttgatgacagaaggctgccgtggtgaagggggctacttgctgaattctgctggggag
agatttatggagcgatatgctccaaaggcaaaggacttggcttcgcgtgatgttgtaagt
cgttcaatgactatggagatacgtgaaggcaggggagtaggtgagaagaaggatcacata
tatttgtctattgcgcatctagatcctaaagtaatccatgagaggcttcctggtataagt
gaaacagcgaagacgtttgctggtgttgatgttactaaggagccaataccggtgattcct
acggttcactacaacatgggtggtatccctactaactatcacggagaggttctatcatta
aatagcagtagtggaagttacgaagtggtagagggtttatttgctataggtgaagccgct
tgtgtatctgtacatggtgcgaatcgtttagggtcgaattctctattggatttggtggta
tttggacgagcagctgcgataagggcgaaagaggttataaagcctggaggtttgcataga
cctattaggaaggattttgaagatagtataatagatagatttgatcgcatgcgttacgct
aacggtgctacgagggttgcggagatacgtagtcgtatgcaaaatgtgatgcaggagcat
gctgcagtattccgtgttgcggaggtgctagagaagggtaaaaaggagatcaggggagtt
gccgcaatgatgaaagatatttcggtaactgataggagtatggtctggaacagcgatctg
gtagaggcattagagctatcgaatatgatgccgcaagctgtagtgactgtagattgtgct
gcaaatcgaaaggagagcaggggtgcgcatgcgcgggaagatttcccagagcgtgatgat
gaaaattggatgaagcatacgatggcgtggtgtaactgcgatacgtatgaagtgaagata
ggctataaagaggtagctacttatactttgacaaatgaagtagagtattttcctccgcag
aaaagggtttattag

DBGET integrated database retrieval system