KEGG   Anaplasma phagocytophilum HZ2: YYU_00795Help
Entry
YYU_00795         CDS       T02753                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
apy  Anaplasma phagocytophilum HZ2
Pathway
apy00020  Citrate cycle (TCA cycle)
apy00190  Oxidative phosphorylation
apy00650  Butanoate metabolism
apy01100  Metabolic pathways
apy01110  Biosynthesis of secondary metabolites
apy01120  Microbial metabolism in diverse environments
apy01130  Biosynthesis of antibiotics
apy01200  Carbon metabolism
Module
apy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
apy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:apy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YYU_00795 (sdhB)
   00650 Butanoate metabolism
    YYU_00795 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YYU_00795 (sdhB)
Enzymes [BR:apy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     YYU_00795 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     YYU_00795 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: AGR78635
LinkDB All DBs
Position
164409..165197
Genome map
AA seq 262 aa AA seqDB search
MVQFSLPKNSKINPNGKVYNATEGAKRTGCFKIYRWSPDDGENPRIDTYYIDLDKCGQMV
LDALIKVKNEYDSTLTFRRSCREGICGSCAMNIDGTNTLACTKYISDIKGDVKIFPLPHM
DVIKDLVPDLSNFYKQYKSISPWLKSDGARSDREEHLQSIEDRSKLDKVYDCILCACCST
SCPSYWWNPDKYLGPAALLQVYRWLVDSRDTATEERLAFLEDAFKLYRCHTIMNCTKTCP
KDLNPAKAIAKIKQMMIKGLEL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagttttctttgccaaaaaactccaagataaacccgaatggtaaggtatacaat
gctacggagggtgctaagcgcactggatgttttaagatatataggtggtcacctgatgac
ggagagaatccgaggattgatacctactatatagatttggacaaatgtgggcagatggtc
cttgatgcgctaattaaagttaagaatgagtatgactcgactttgacttttaggaggtca
tgtcgtgaggggatatgtggatcgtgtgcgatgaatatagatggcacgaacactttggca
tgtacgaagtatatttctgatattaagggagatgtgaaaatatttcccttaccgcatatg
gatgttatcaaagatttggtgccggatttaagtaatttttacaagcaatataagtctata
agtccttggttgaagtctgatggtgcgaggtctgatagggaggagcatcttcagagcata
gaggacaggagtaagttggacaaggtatacgattgcattttgtgtgcgtgttgtagtaca
agttgtccgagttattggtggaatccagataagtatttgggacctgcggcgttgttgcag
gtatacaggtggttggttgatagtagggatacggcgacagaggagcgtcttgcgttttta
gaggatgcttttaagttatacaggtgtcatactatcatgaattgtactaagacttgtccc
aaggatctgaatcctgctaaggcgatagcgaaaataaagcagatgatgataaaaggattg
gagctctag

DBGET integrated database retrieval system