KEGG   Anaplasma phagocytophilum HZ2: YYU_05575Help
Entry
YYU_05575         CDS       T02753                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
apy  Anaplasma phagocytophilum HZ2
Pathway
apy00061  Fatty acid biosynthesis
apy00780  Biotin metabolism
apy01100  Metabolic pathways
apy01212  Fatty acid metabolism
Module
apy_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:apy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YYU_05575
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YYU_05575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:apy01004]
    YYU_05575
Enzymes [BR:apy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     YYU_05575
Lipid biosynthesis proteins [BR:apy01004]
 Fatty acid synthase
  Component type
   YYU_05575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AGR79077
LinkDB All DBs
Position
complement(1282727..1283170)
Genome map
AA seq 147 aa AA seqDB search
MSMQMDHKQVMRALPHSYPFLLVDKVTECIPGECIVAVKNVTFNEPFFVGHFPGNPIMPG
VLIVEALAQASMLCVVCDADGESTGDTSVLFMSIDSARFRKVVVPGDVLVLKSSVCHRRG
NSCRFDCRAYVEDVLVTEAQILAMMNK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
gtgtctatgcagatggatcataaacaggtaatgcgagcattgccgcactcttatccattt
ttgttggtggacaaagtgacggagtgtattcctggagagtgtatcgttgcggttaagaat
gttacgttcaatgagccgttttttgtggggcattttcctggtaaccccatcatgccgggg
gtgcttattgtagaggctttggcgcaggcttctatgttgtgtgttgtgtgtgatgctgat
ggggagagtacgggtgatacgtctgttctttttatgtccattgattcagcgagatttcgc
aaggttgtagtgccgggggatgttttagtgttgaaatcaagtgtgtgtcatagacgtggt
aacagctgtaggtttgactgtcgtgcttatgtagaagatgtcttggtgactgaggcgcag
atcttggcaatgatgaataaatag

DBGET integrated database retrieval system