KEGG   Anaplasma phagocytophilum HZ2: YYU_05810Help
Entry
YYU_05810         CDS       T02753                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apy  Anaplasma phagocytophilum HZ2
Pathway
apy00010  Glycolysis / Gluconeogenesis
apy00020  Citrate cycle (TCA cycle)
apy00620  Pyruvate metabolism
apy01100  Metabolic pathways
apy01110  Biosynthesis of secondary metabolites
apy01120  Microbial metabolism in diverse environments
apy01130  Biosynthesis of antibiotics
apy01200  Carbon metabolism
Module
apy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YYU_05810
   00020 Citrate cycle (TCA cycle)
    YYU_05810
   00620 Pyruvate metabolism
    YYU_05810
Enzymes [BR:apy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YYU_05810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AGR79098
LinkDB All DBs
Position
1333957..1335219
Genome map
AA seq 420 aa AA seqDB search
MPVKVLMPALSPTMKSGTIAKWHKNAGDAVKPGDIVADIETDKAVIEFEYADEPGVMYKI
LKEEGSKNVAVNQSIAVIKVDGDEEAALLEMVHSAEGASGSVSNEAASAALQATPAKVAG
DMVAPSSANKASETAHITSGSDRVKASPLAKKLAAQLSVDISKITGSGPYGRVVKADVLG
ASVPTSDTTIQEGSRVVEVSTMRKVISERLAESKRNIPHFYLAIDCMVGELLEVRSRINS
NAEALGTKITVNDLVIKATALAAREFPEVNALWAGDKIVYHQNVDIAFAVALDDGLLTPV
IAGADKMTLSELSKTAKSLVARAKDRKLLPHEFQGGCLTISNLGMFCIKEFYAIINPPQS
CIMAVGQSEKRPVVVDNCVVAADVMSVTLSVDHRVIDGALAAKFLNRFKFYIENPLAMLA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgaaggtcttaatgcctgccctctcgcctactatgaagagtggtacaatagcg
aagtggcataaaaatgccggagatgctgtaaaacccggggatatagtagcggatattgag
accgacaaagcggtgatagagtttgaatacgcggatgaacctggtgtaatgtacaaaatc
ctcaaagaggaaggtagcaaaaatgtggctgtaaaccagagcattgctgttattaaagta
gatggagatgaggaagcggcgttgctggagatggtgcattctgcggaaggcgcgtcaggt
agtgtttcgaatgaagcggcttcggcagcgttgcaagctacgccagccaaggttgcgggc
gatatggttgctcctagttctgctaacaaggcgagtgaaacagcgcatattacatctggt
agtgatagagttaaggctagtccattggcgaagaagctagctgctcagctgtcagtggat
atcagtaagataactggttctgggccatatggcagagtagtgaaagcggatgtgctgggt
gcttctgtgcccactagtgatacgactatacaagagggtagtcgcgttgttgaagtcagt
accatgcgcaaggttatatctgaacggcttgcagagtcgaagcgcaatataccacacttc
tatctagcaatagattgtatggtgggtgagcttttagaggtacgatctaggatcaatagc
aacgctgaagctttggggaccaaaattactgttaatgaccttgtgataaaggcaactgca
ttagctgcgcgggagtttccggaggttaacgctttatgggcgggagataaaatagtatac
catcagaatgtggatattgcatttgctgtggctttggatgatggtttacttaccccggtt
attgctggtgctgataagatgactttgtctgagctttctaagacggcgaaaagtcttgtt
gcccgtgctaaggaccgtaaactcctgcctcatgagttccaagggggctgtttgacaatc
tcaaaccttggtatgttttgtatcaaggagttttatgcaataataaatcctcctcagtcc
tgtattatggctgttgggcagtctgagaagcgtcctgtggttgtggataattgtgtggtt
gctgcggatgttatgtcagttaccttgtcggtggatcatagggtaatagatggagcgttg
gcagctaagtttttgaacagattcaaattctacattgaaaatccgctggctatgctggct
tag

DBGET integrated database retrieval system