KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_01110Help
Entry
APA32_01110       CDS       T01817                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
apz00620  Pyruvate metabolism
apz01100  Metabolic pathways
apz01120  Microbial metabolism in diverse environments
apz01200  Carbon metabolism
Module
apz_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:apz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APA32_01110
Enzymes [BR:apz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     APA32_01110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-ProteinID: BAI13510
NITE: APA32_01110
LinkDB All DBs
Position
complement(123119..124753)
Genome map
AA seq 544 aa AA seqDB search
MPSASTPQLRGMALLNNAHLNKGTAFTEEERRLYGLEGLLPTQVENLDRQVERIHRHLEA
KPSNLERYIYLSGLRDQNETLFYKVLMSNPARFVPIVYAPTLAAVCQQFSHIYRRPRGMY
ISLDMRGRIKDVLQNWPMDNVRFMCVTTGGRILGLGDIGVNGMGIPIGKLDLYTACGAVP
PDSLLPVQLDIGTTNSALRADPLYLGLRREPPPIEELDSFVEEFIEAVQEVFPQSCIHFE
DWKGTDALRYLKKYHDRVLCYNDDIQGTAAVTLAGLITALKIKNESLTQQRFLFLGAGSS
GIGTADMLVSALKQEGLSEQEAIDRITLMDVNGLLETSRTDLLPEQERFAKDLPPSRDLL
GMIKTVKPTVLIGVSTAGGSFTQEVVEEMSKLNERPIIFPLSLPQKNGECTAEQAYEWSK
GRALFAAGLQYPEVTYNDRTFYPGQANNFYIFPALGLAVYATCPKLITDEMVIEAAQALA
DQVDPAARERGRLFPPQSDILEVSITSATRIAEFIFDKNAATVERPKDIRAWIENLTYKP
RYTD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgccctctgcttccacgccccaactgcgaggaatggcccttcttaataatgcgcacctg
aacaagggcacggcgtttaccgaggaagagcgccgcctttatgggctggaaggactgtta
cccacacaggttgaaaacctagataggcaggtagaacgtatccaccgccatcttgaggct
aaacccagcaatctggaacgctatatctatctgagcggcttgcgcgaccagaacgaaacc
ctgttttacaaggttttgatgtctaaccccgcccgattcgtgccgattgtgtacgcaccc
acgctggccgccgtatgccagcaattcagccacatctatcgccgcccacgcggtatgtat
atcagcctggatatgcgtggccgtattaaggatgtgctgcaaaactggcctatggataat
gtgcgcttcatgtgtgtgaccacaggcggtcgcattcttgggcttggtgatattggcgta
aatggcatgggcatccccattggcaagctggacctttatacagcctgcggcgcagtgccc
cccgattcgcttttgcctgtgcagcttgatattggcaccacaaacagcgccttaagagct
gatcctctgtatctgggcctgcggcgtgaaccacccccgatagaagaactcgattctttt
gtagaagaatttattgaggccgtgcaggaagtcttcccgcaaagctgtatccattttgag
gattggaagggcacggatgccctacgctacctcaaaaaatatcatgaccgtgtgctgtgc
tataacgatgatattcaaggcacagcggctgtaactttggccggtctgattacagcactg
aaaatcaagaacgaatcgcttacccagcaacgcttcttgttcttgggggcgggttcttcc
ggcattggtactgccgatatgctggtttccgccttgaaacaggaagggctatctgaacaa
gaagccattgaccgcattacgttaatggatgtgaacggtcttttagaaacctcacgcact
gatctgctgcccgaacaggaacggttcgccaaggatcttccgccatcgcgtgacctgctg
ggcatgatcaaaactgttaaacccacagtgctgattggtgtttccactgctggcggttct
ttcacccaagaagtggtggaagaaatgagcaagctgaacgaacgccccattattttcccg
ctttctctgccgcagaaaaatggggaatgcacggctgagcaggcctatgaatggtctaaa
gggcgtgcgctttttgctgcaggcctacagtacccagaagtgacgtataatgaccgtacg
ttctatccggggcaggccaataacttctacatcttcccagctctgggtctggctgtgtat
gccacctgccccaagctgattacagatgaaatggtgattgaagccgcacaggctctggca
gatcaggtagatccggcagcgcgtgaacggggccggctgttcccgccacaaagcgatatt
ctggaagtgtccatcacctccgccacacgcattgcggagtttatttttgataaaaacgct
gcaacggtggaacgccccaaagacattcgggcgtggattgaaaatctgacttacaagcca
cgctacacagactaa

DBGET integrated database retrieval system