KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_18390Help
Entry
APA32_18390       CDS       T01817                                 

Definition
(GenBank) O-succinylhomoserine sulfhydrylase
  KO
K10764  O-succinylhomoserine sulfhydrylase [EC:2.5.1.-]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
apz00270  Cysteine and methionine metabolism
apz00920  Sulfur metabolism
apz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    APA32_18390
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    APA32_18390
Enzymes [BR:apz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.-  
     APA32_18390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Met_gamma_lyase GDC-P Beta_elim_lyase SelA
Motif
Other DBs
NCBI-ProteinID: BAI15206
NITE: APA32_18390
LinkDB All DBs
Position
1993767..1994975
Genome map
AA seq 402 aa AA seqDB search
MSDNKIAFSEAWRPATRQLHAGVERTEYGETSEAVFLTSGFVYDNAEQAARTFRGEEEHY
QYSRFGNPTVAALERRLADLEGAEACVATATGMGAVSSALLSHVKAGDRVVASRALFGSC
HWIVANLLPRYGVETVFVDGCNPDEWAKALSQPTAAVLLESPSNPMLDILDIKAISDLAH
KAGAIVVVDNVFASPVFQKPLQLGADVVVYSCTKHIDGQGRVLGGAVLGRKDWITETLQP
FTRNTGNALSPFNAWVMLKGLETLSLRVNAMAANAAAVADYLASAPGIVSVRYPGRADHP
QYELAKRQMSGSGSLIAFEVKGGQKGAFAFMDALKLIAISNNLGDARSLVTHPATTTHSK
VSAEDRAVLGITDGAIRFSVGLEDSADLIDDLARGVAALQAI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaacaagattgcattttctgaagcgtggcgccccgcaacccgtcagctccat
gctggtgtggaacgcacggaatatggtgaaaccagcgaagccgtgtttctgacctccggc
tttgtttatgacaacgctgaacaagccgcccgcaccttccgcggtgaggaagaacactat
cagtatagccgctttggcaaccccacagttgccgcgctggaacgccggctggcagatctg
gaaggtgcagaggcctgtgtggcaacggctacaggcatgggtgctgtttcgtccgccctg
ctcagccacgttaaagccggagatcgggttgttgcctcccgcgcgctgtttggctcctgc
cactggattgttgccaaccttctgccccgttatggcgtagaaaccgtttttgtagatggc
tgtaacccggacgaatgggcaaaagcactttcccaacccacagccgccgtgctgctggaa
agcccatccaaccccatgcttgatattctggatatcaaggccatttcagacctcgcccac
aaggctggtgcaattgtggtggtggataacgtatttgcttcccccgtgtttcagaagcct
cttcagttgggtgcggatgttgttgtctattcctgcaccaagcacattgatggccagggc
cgcgtactgggcggggccgtgctgggccggaaagactggattacggaaacacttcagccc
ttcacccgtaatacaggcaatgcgctttcacctttcaatgcatgggtgatgctcaagggg
ctggaaacactttccctgcgcgttaacgccatggcagccaacgctgcggctgtggccgat
tatctggcatctgcccccggtattgtcagcgtgcgctacccgggccgggccgaccacccg
cagtatgaactggccaaacgccagatgagcggcagcggaagcctgattgcctttgaggta
aagggtggccagaaaggcgcgtttgccttcatggacgcgctgaagctaattgccatttcc
aacaaccttggggatgcacgctctttggtgacacacccagccacaaccacacattccaag
gtgagcgcagaagaccgcgctgttctgggcattacggatggcgccatccgcttttccgtc
gggctggaagacagcgcagatctgattgacgatctggcccgcggtgttgcggcccttcag
gctatctaa

DBGET integrated database retrieval system