KEGG   Acetobacter pasteurianus IFO 3283-32: APA32_23110Help
Entry
APA32_23110       CDS       T01817                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
apz  Acetobacter pasteurianus IFO 3283-32
Pathway
apz00030  Pentose phosphate pathway
apz01100  Metabolic pathways
apz01110  Biosynthesis of secondary metabolites
apz01120  Microbial metabolism in diverse environments
apz01130  Biosynthesis of antibiotics
apz01200  Carbon metabolism
apz01230  Biosynthesis of amino acids
Module
apz_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:apz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    APA32_23110
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    APA32_23110
Enzymes [BR:apz01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     APA32_23110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N LEA_6
Motif
Other DBs
NCBI-ProteinID: BAI15665
NITE: APA32_23110
LinkDB All DBs
Position
2504374..2506476
Genome map
AA seq 700 aa AA seqDB search
MRVSLPTPVRAPAQTQGSGASSLDTLCINTIRALVMDTVQKANSGHPGAAMSMAPLTYTL
WQNLLNYDPTNPLWPNRDRFVLSIGHASALLYSMIHLSGIRQVTNGKVTNAPALTTADLE
QFRQLGSKTPGHPEHGHTTGVETTTGPLGAGCGNSVGMAMAEKWLTARFNQPGFELFNHH
VYTLCGDGDMMEGVSSEAASLAGHLQLGNLIWIYDSNRISIEGGTNIAFTENVAERFAAY
GWQVLELKDANDTAAFTQLIAQAKAETSRPSIIIAHSVIAWGAPNKAGMASAHGEPLGAE
EVRETKKFFGWPEDSSFLVPEEALQHMQDGLGARGAAASAAWNKLFASYHSSHPALAAEL
DAIFNGTLPEGWDADIPVYETSAKGEASRASSGAVLNAVAGRLPWLLGGSADLAPSTKTL
LKGEKSFQPAQWGGSYAGRNFHFGVREHAMGAIVNGMALYGLRPYAAGFLIFSDYMKPPI
RLSSIMGLPVTYIFTHDSIGVGEDGPTHQPIEQLVQLRATPGLVTLRPADANEVAEAWRF
LIQHRNGPTALALSRQNLPTLDRTRYAPASGLTKGAYVLASSEQTPKVILIASGSEVSLA
VGAYEALSAEGVPARVVSMPSWELFEAQPQSYRESVLPAAVTGRVVIEAGSAIGWDRYAG
PKGEIIAMHGFGASAPAGKLLEKFGFTPEAVLAAAKRQAG
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtttctcttcccactcctgttcgcgcacctgcacaaacgcagggcagtggcgca
tccagccttgatacgctgtgcatcaacaccattcgcgcacttgtcatggacactgtgcag
aaggccaattctggccatccgggggcggccatgtccatggcgccgctgacctatactcta
tggcaaaacctcttaaactatgacccgaccaacccgttgtggcccaatcgggatcggttt
gtactttctattgggcatgcctctgccctgttgtattccatgattcatctgtccggcatc
cggcaggttacaaatggcaaggttacgaatgctccggcccttacaacggctgatttagag
cagttccgccagcttggctccaaaaccccaggccatccagaacatgggcacacaaccggc
gtagaaaccacaaccggcccactaggtgctggctgtggtaactccgttggcatggccatg
gctgaaaaatggttgactgcacgcttcaaccaaccgggtttcgagctgtttaaccaccat
gtttacaccctgtgtggtgatggtgacatgatggaaggcgtcagcagcgaagcagcctcc
cttgccggtcatcttcagcttggcaacctgatctggatttacgattccaaccgtatctcc
attgagggcggcaccaacattgcatttacagaaaatgtggcagaacgctttgccgcctat
ggctggcaggttctggaactgaaggacgccaatgataccgcagccttcactcagctaatc
gctcaagccaaggctgaaaccagccgccccagcattattattgcacattcggttattgca
tggggtgcgcccaataaagctggcatggcctccgcccacggggaacctttgggcgcagaa
gaagtgcgtgaaaccaaaaagtttttcggctggccggaagacagcagcttccttgttcca
gaagaagcactgcaacatatgcaggatggtttaggggcccgtggggccgccgccagtgct
gcatggaacaaactgtttgccagttaccattcctcgcaccccgctttggctgcagaactg
gatgccattttcaacggcactctgccagaaggctgggatgcggatattccggtttatgaa
accagcgcaaaaggtgaggcctcccgcgccagctccggtgcagtgcttaacgctgtagct
ggccgtctgccttggctgctgggcggatctgcggatctggcaccatccaccaaaacgctg
ctaaaaggtgaaaaaagcttccagcctgcacaatggggtgggagctatgctgggcgcaat
ttccacttcggggtgcgtgagcatgccatgggagccattgtaaatggtatggccctgtat
ggcctgcgcccctatgcggctggctttctgattttttcagattacatgaagccccctatc
cgcctttcctccattatgggcctgcctgtcacttatatcttcacccatgattccatcggg
gtgggcgaagatggccccacacatcagcccatcgaacaactggtgcagctgcgtgctacg
ccgggcttggtaacgctacgcccagccgatgccaatgaagtggccgaagcatggcgtttt
ctgatccagcatcgcaatggccccaccgctcttgctctaagccgccagaatctgcctacg
cttgatcgtacccgttacgcgccggcttctggcctcacaaaaggggcttatgttcttgca
agcagtgagcagacaccaaaggttatcctgattgcatcgggcagcgaagtttctctggct
gtaggggcgtatgaagccctgagcgcagaaggtgttccggcccgcgttgtttccatgccc
agttgggaactttttgaagcgcagccacaatcttaccgtgagagcgtgctacccgccgct
gtaacaggacgtgtggttatagaagcaggctccgccattggctgggatcgctatgccgga
ccgaagggtgaaatcattgccatgcacggctttggtgcctcggctccagcgggcaaactg
cttgaaaaatttggttttacgccagaagccgttttggcagctgccaagcggcaggcaggc
taa

DBGET integrated database retrieval system