KEGG   Aquimarina sp. AD1: D1815_02670Help
Entry
D1815_02670       CDS       T05625                                 

Definition
(GenBank) hypothetical protein
Organism
aqa  Aquimarina sp. AD1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_8 LRR_4 DUF5018 LRR_9
Motif
Other DBs
NCBI-ProteinID: AXT54708
UniProt: A0A3A9WDL0
LinkDB All DBs
Position
564969..566282
Genome map
AA seq 437 aa AA seqDB search
MKGLLTYKNLLLVMCSLIIFSCSKEIDGSDVILLNNEKEILEFTFLSSDNEELEIDVSAR
IDQNDKIISVVLPYGTPVRALKPNIKVSESASIIQGTDIFVDFSDPLNYSVIAEDGTTSD
YTVRVRVVASTDQEILLTIFNQNPDNTLGWDITSDNVSAWEGIVVIDEKIIGLELDEKGL
TILPPEICDLFYLKTLSLEGNMITEIPRQIEDLSNNLRVLNLGGNQIEIIPGEFFSLEKL
TDLRMYTNMLVDIPADINKLTELRYLSLSNNALQTLPSELFELSELNTLFINNIELLEVP
QEITNLSKLTSLGISSNQLGSVPDHVLEIETLTRLDIYNAGISTIPSGITKLSNLRRLQL
SGNNLVDINENVGDLFLLENLLLKTNMIEEIPVKLSNLINLQVLDISENNIFSMPNAVCD
LVNTGTEIVIDAGVGCM
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcttattaacctataaaaacctacttttagtaatgtgtagtttgatcatattt
tcttgttctaaagaaatagatgggtcagatgttattttactaaataacgaaaaagaaata
ttagaatttacatttctctcatcagataatgaagaattagagattgatgttagtgctcgt
atagatcagaatgataagataatatctgtagtattaccatatggtactccagttagagca
ttgaaacccaatataaaagtttcagaatctgcatccattatccaaggtacagatattttt
gtagatttttccgatcctttaaattatagcgtgattgcagaagatggtacaacttcagac
tatacagtaagagtacgagttgttgctagtacagatcaagagattttacttactattttt
aatcaaaaccctgataatacacttggctgggatataactagtgacaatgtttctgcttgg
gaaggtatcgtagttatagatgagaagataatagggttagagttagatgaaaaagggctt
accatattaccgccagaaatctgtgacttgttttaccttaaaacattatcgttagaaggt
aatatgattacagaaattccaagacagattgaagatttgtctaataacttaagagtgttg
aatctcggtggaaatcagatagaaataattccaggagaattttttagcctagaaaaacta
acggatctaagaatgtataccaatatgttagtagatataccagctgatattaataaactt
acagaactgagatatttgagtttgtctaataatgctttacaaacactgccttcagaactg
tttgaactctcggaattaaatacattattcattaataatatcgaattattagaggtgcca
caagaaataacaaacctatctaaattaactagtttaggaatctcctccaatcaattagga
tccgtaccagatcatgttttagaaatagagacattaactaggttagatatttacaatgca
ggtataagtactattccttcaggaattacaaaactatccaatctaagaagacttcagtta
tctggaaataatttagttgatattaatgagaacgtaggggatttatttcttttagaaaac
ctgttgttaaaaacgaatatgatagaagaaatacctgttaaacttagtaatttgataaat
ttacaagtattggatatttcggaaaataacattttttctatgccaaatgctgtatgtgat
ttagtaaatacagggactgaaattgtaattgatgctggtgtaggatgtatgtaa

DBGET integrated database retrieval system