KEGG   Aquimarina sp. AD1: D1815_04095Help
Entry
D1815_04095       CDS       T05625                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aqa  Aquimarina sp. AD1
Pathway
aqa00620  Pyruvate metabolism
aqa00680  Methane metabolism
aqa01100  Metabolic pathways
aqa01120  Microbial metabolism in diverse environments
aqa01200  Carbon metabolism
Module
aqa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aqa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D1815_04095
  09102 Energy metabolism
   00680 Methane metabolism
    D1815_04095
Enzymes [BR:aqa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     D1815_04095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AXT54974
UniProt: A0A3A9XLF2
LinkDB All DBs
Position
900021..902603
Genome map
AA seq 860 aa AA seqDB search
MARQPKIDRFNHNVLTKYQIYNSIFITLPFDEITNTGVLLPLFKEVCEKGYDQKMNPSEI
VENFFTSYQDDPSDKDKHDLLFRFIQYIERQVVLFDAIEDAAFPIVNNMDGRGTLRSIKE
EAQAKGQLEELKEYLRRFKIRPTLTAHPTQFYPGTVLGIIHDLDTAIRDNDSQKIKRLLA
QLGKTAFFKKEKPTPYDEAVSLIWYLENVFYHSVGTIYNYIQQNIFKGEDLENDLINLGF
WPGGDRDGNPFVTTETTLKVAKRLRKTILINYYRDMRKLKRRITFGNLQDKLGVLESALY
DNFYYAKTAEPLSIYTLMNGLLEVREELISKHQSLFLEELQDLINKVKIFGFHFGTLDIR
QDSRVHHGVLTEIVKKTNDLGLGFFPENYETLSEEEQIKVLSTVTGKLDPSVLDNDMARA
TIESIYAIKTIQNNNGERGSNRYIISNNGSVLNVMEAFAMIRLCDWEKPTVDVIPLFETV
PDLRVSHQVMETLYSNPVYMEHLKSRGMKQTIMLGFSDGTKDGGYLMANWGIFKAKEALT
EISRKYNVKVIFFDGRGGPPARGGGNTNQFYASLGPTVEDEQIQITVQGQTISSNFGTLD
SCQYNLEQLLGAGVENQLTANEANLFSKENKVTMQELADISYQTYVDFKNHPKFLPYLEH
MSTLKYYGKANIGSRPSKRSKSSSLDFGDLRAIPFVGSWSQLKQNVPGFYGVGTALKTFE
DRDEFDKITSLYKESAFFRALLGNSMMSLTKSFFQLTAYMKEDEEYGAFWNIIHDEYTLT
KRLLLKLTGYSELMENEPAGKASIDIRENIVLPLLTIQQYALKKIQDINRTGEDAEDLEI
YEKMVTRSLFGNINASRNSA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacaaccaaaaatagatcgttttaaccacaacgttcttactaaatatcagata
tacaatagtatatttattacattaccttttgatgaaatcactaatacaggtgtattatta
cctctttttaaagaagtttgtgaaaaagggtatgatcaaaagatgaacccttcagaaata
gtagaaaacttctttacatcttatcaagatgatccttcagacaaggataagcatgatttg
ctgtttagatttattcagtatatagaacgtcaggtagtattgtttgatgctatagaagat
gcagcgtttccgatcgttaataatatggacggaagaggtacgctacgaagcattaaagaa
gaagcacaagcaaaaggacaactagaagaattaaaggagtatttaaggaggtttaagatt
agaccaactttaacagcgcatcctacacaattttatccaggtaccgtattaggtattatt
catgatcttgatacagcaataagagataatgattctcaaaaaataaaaagattactagca
caattaggtaagactgcattttttaaaaaagaaaagcctactccgtatgatgaagctgtt
agtttaatatggtatttagaaaatgtattctatcattctgtagggactatttataactat
attcaacaaaatatattcaaaggagaagatctcgaaaacgatctaataaacctaggtttt
tggcctggaggagatagagatggaaatccatttgtgacaacagaaacgactctcaaagtt
gcaaaaagattacgtaaaactatattgattaattattatagagatatgcgtaagttaaaa
cgtagaattacctttggaaatttgcaggataaattaggagttctagagtctgctttatat
gataatttctattatgctaaaacggctgaacctttatctatatataccttaatgaatggt
cttttagaagtaagagaagaattaataagtaaacatcagtctctgtttttagaagaatta
caggatttaattaataaggtaaagatttttggtttccattttggaactttagatatcagg
caagattctagagtacatcatggtgtgcttactgagatcgtaaagaaaactaatgattta
ggattaggtttttttccagaaaattacgaaacattatcagaagaagaacagataaaggta
ttgtctactgtaacaggaaaattagatccttcagtattagataatgatatggctagagct
acaatagaatctatttatgcaattaaaaccatacagaataataatggagagcgaggatca
aatcgttacataattagtaacaatggtagtgttcttaatgtcatggaagcttttgctatg
attagattgtgtgattgggaaaaacctactgttgatgtaataccactgtttgaaactgtt
cctgatcttcgtgtatctcatcaggtgatggagacattgtatagtaatccagtttatatg
gagcatctaaagagtcgaggaatgaaacaaactattatgttaggtttctctgacggtaca
aaagatggtggatatctgatggcaaactggggtatttttaaagctaaagaagcacttaca
gagatttctagaaaatataatgtaaaagtaatattctttgatggtcgaggtggtccacca
gctagaggaggaggaaatactaatcaattttatgcatctcttggcccaacggtcgaggat
gaacaaattcaaataacggtccaaggacaaaccattagttctaatttcggaacactagat
tcttgtcaatataatttagaacaattgttaggagctggagtagagaatcaactaacagca
aacgaagccaatcttttttctaaagagaataaagtgacaatgcaagaattggcggatatt
agttatcaaacctatgtggattttaaaaaccatcctaagtttttaccatatttagagcat
atgagtacgcttaaatattatggaaaagcgaatataggtagtcgtccttctaaacgtagt
aaaagtagtagtttagattttggagacttaagagcaataccatttgttggtagttggagt
cagttaaaacagaatgttcctgggttttatggggttggaacagccttaaaaacttttgaa
gatagagacgaatttgacaaaataacaagtctgtataaggaatcagctttttttagagcg
ttgttagggaatagtatgatgagtttgactaaatcgttttttcaattaacagcttatatg
aaagaagatgaagaatatggcgctttttggaatattatacatgatgaatatacacttact
aaacgcctattgttaaaactaacaggatattctgagttaatggaaaatgaaccagcaggg
aaggcttctatcgatattagagaaaatattgtacttccattgctaactattcagcaatat
gcattaaagaaaatccaagatattaatagaactggagaagatgcagaggatttagaaatt
tatgaaaaaatggtgacgcgttcattatttggaaatattaatgcaagtcgtaattctgct
tag

DBGET integrated database retrieval system