KEGG   Aquimarina sp. AD1: D1815_19445Help
Entry
D1815_19445       CDS       T05625                                 

Definition
(GenBank) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
aqa  Aquimarina sp. AD1
Pathway
aqa00620  Pyruvate metabolism
aqa01100  Metabolic pathways
aqa01120  Microbial metabolism in diverse environments
aqa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aqa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D1815_19445
Enzymes [BR:aqa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     D1815_19445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M AlaDh_PNT_C ELFV_dehydrog Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: AXT57823
UniProt: A0A3A9YCS2
LinkDB All DBs
Position
4536403..4538715
Genome map
AA seq 770 aa AA seqDB search
MSIESKRREALIYHAKPTPGKIKVVPTKKYATQRDLSLAYSPGVAEPCLEIEKDTANVYK
YTAKGNLVAVISNGTAVLGLGDIGPEASKPVMEGKGLLFKIFADIDVFDIEVDTKDVDAF
IETVKNIAPTFGGINLEDIKAPEAFEIERRLKEELDIPVMHDDQHGTAIISAAALLNALE
IAGKDIDKVKIVVSGAGAAAVSCTRLYKAFGAKAENIVMTDSKGVIRKDRDNLTPEKAEF
ATDRNLDTLADAMKDADVFIGLSMANLVDPEMLLSMTNDPIVFAMANPDPEIRYDLAVQT
RKDIIMATGRSDHPNQVNNVLGFPFIFRGALDVRATGINEEMKMAAVKALADLAKEPVPE
QVNIAYGETRLNFGRDYIIPKPFDPRLIAKVPPAVAKAAIESGIATEPIEDWDKYESELL
ERMGNDNKLVRLLMDRAKLSPKRVVFAEGDHLDVLKAAQTVKEEGIAFPILLGRKDIIAE
LMKELDFDPAGVTIIDPKADEEIDRKNRYAQKYWQDNSRKGITLYGAQRLMRERNYFAAM
MVNEGDADALLSGYSRSYPTVLKPILELIGLAKGATRIATMNVMMTNKGPLFISDTSINI
DPTSKELAKIAQMTARTVEMFGVDPVIAMISYANFGSSKHPNASKVKDAVSYLHRYYPNL
VVDGELQMDFALNRDMRKDKFPFSKLNGRKVNTLVFPNLDSANSTYKMLKELNNSESIGP
IMMGMKKPVHILQLGASVEEMVNVAAVAVIDAQEKEKREKEMFSLTSSDV
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaagtaaacgaagagaagcgctaatttatcatgcgaaacccactcctggt
aaaatcaaagtagtacctacaaaaaaatatgcaactcaaagggatttgtcattggcatac
tctcctggtgtagcagaaccttgtttagaaattgaaaaagatacagcaaatgtatataag
tatactgcaaaaggaaatttagtagcggtaatatctaacggtactgctgttttgggacta
ggtgatattggtccagaagcttctaagcctgttatggaaggaaaggggttgttgtttaaa
atttttgcagatattgatgtatttgatattgaagttgacactaaagatgtagatgcattt
attgaaacagtaaaaaatatagcacctacttttggaggaatcaatctagaggatattaaa
gctccagaagcgtttgaaatagagaggcgtctaaaagaggaactagatattccggtaatg
cacgatgaccaacatggaacagctattatttctgccgcagccttgttaaatgcactagaa
atcgctggaaaggatattgataaagttaaaatagtggttagtggagctggagctgcagca
gtttcttgtacaagactatataaagcttttggagcaaaagctgaaaatatagtaatgact
gatagtaaaggtgtaattcgtaaagatcgagataacctaactccagaaaaagcagaattt
gcaacagatagaaatcttgatacccttgcagatgctatgaaagatgctgatgtgtttata
ggcttatctatggctaatttagtggatccagaaatgttgttgtcaatgactaatgaccct
attgtatttgccatggcaaaccctgatccagaaataagatatgatttagcggtacaaacg
cgtaaggatattattatggctacaggaagaagtgaccatcctaatcaggtaaataatgtt
cttggttttccatttatatttagaggagcattagatgtaagggcaactggtataaatgaa
gaaatgaaaatggcggctgtaaaagcgctggcggatttggctaaggaaccagtgccagag
caagtaaatatagcatacggagaaactagacttaattttggtagggattatattatacca
aagccttttgatcctagattgatagccaaagttcctccagcagttgctaaagctgcaata
gaaagcggcatagctacagaaccgatcgaggattgggataagtatgaaagtgagctctta
gaacgaatggggaatgataataaattggtgagattgttaatggatcgcgccaagctaagc
cccaaaagagttgtttttgcagaaggagatcatttagatgttttaaaggcagcacaaaca
gtaaaagaagaaggaatagcttttccaatattattaggtcgtaaagatattattgcagaa
ctaatgaaggagcttgattttgatcctgctggggttactattatcgatcctaaggcagat
gaagaaattgatagaaaaaacaggtatgctcagaaatattggcaagataatagccgaaaa
ggaataactctttatggagctcaaagattgatgcgagagcgtaattactttgctgcgatg
atggttaatgaaggtgatgcggatgcattgttgtcaggatattctcgaagttatccaaca
gtattaaagccaatattagagcttattggattggcaaaaggagctactaggattgctacc
atgaatgtaatgatgacgaataaaggaccattgtttattagcgatacttctattaatatt
gatcctacttctaaggagttagcgaagatagctcaaatgacggcaagaacagtagagatg
ttcggtgttgaccccgttatagcgatgatatcctacgctaattttggatcttcaaaacat
cctaatgcttctaaagtaaaagacgcagtttcatacttacatcgttattatcctaactta
gttgtggatggagaattgcaaatggattttgctttaaatcgagatatgcgaaaagataaa
ttccctttctctaagcttaacggtcgtaaagtgaatactttagtttttcctaatttagat
tctgccaacagtacgtataaaatgctgaaagaattaaataactcagaatccataggaccg
ataatgatgggaatgaaaaaaccagttcatatacttcagttaggtgctagtgtagaagag
atggttaatgtagcagcggttgctgtaatagatgcccaggaaaaggaaaaaagagaaaaa
gaaatgttctcacttacgtcgagtgatgtatag

DBGET integrated database retrieval system