KEGG   Aquimarina sp. AD1: D1815_22090Help
Entry
D1815_22090       CDS       T05625                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
aqa  Aquimarina sp. AD1
Pathway
aqa00380  Tryptophan metabolism
aqa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    D1815_22090 (kynU)
Enzymes [BR:aqa01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     D1815_22090 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AXT58322
UniProt: A0A3A9WQD6
LinkDB All DBs
Position
5129855..5131135
Genome map
AA seq 426 aa AA seqDB search
MQFENSKEFAQKLDQQDPLSSYRDQFLFPKVNGKEVIYFTGNSLGLQPKNTKKYVDEVMK
DWAELAVEGHFYADMPWWDYHERLAKPLSRIVGANPSEITVMNTLTVNLHLLMVSFYRPQ
EKRYKIICEEKAFPSDQYMLHSQVRFHGYDPKDAIVEIKKRPGEHNFRIEDILSTIKSVG
EECALILIGGVNYYTGQVFDMKTITKAGHDIGAFVGWDLAHGAGNIELKLHDWDVDFASW
CSYKYMNSGPGNASGCFVHERFHDRKDIPRFEGWWGTKKESRFLMEPEFEPMPNADAWQL
SNAPILSLAPYLASLELFEKVGMEALIEKRNLIVAYLEFVLKSIDLEVESTFEIITPSSQ
EERGTQLSVFLHGEGRKLFDYLMKNGVITDWREPNVIRLAPAPFYCSYEDMYEFGQILKK
GVLQKV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgaaaacagtaaagaatttgctcaaaagttagatcaacaagatcctttaagc
tcttatagagatcaatttctttttcctaaagttaatgggaaagaggtcatatattttaca
ggaaattctttaggacttcaacctaaaaacacaaagaagtatgtcgatgaagtaatgaaa
gactgggcagaacttgctgttgaaggacatttttatgcagatatgccttggtgggactat
cacgaacgtttagccaaacccctaagtagaatagttggagctaatccctctgagattaca
gttatgaataccttaacagtaaatcttcatttactaatggtttcattttaccgacctcaa
gagaaacgatataagattatatgcgaggaaaaggcatttcctagtgatcaatatatgtta
catagtcaggttagatttcatggatatgatccaaaggatgctattgtagaaattaagaaa
cgtcctggagaacataattttaggatagaagatattttatctactattaaatcagtagga
gaggagtgtgctttgattttaatcggtggtgttaattattatacaggtcaggtttttgat
atgaaaactattactaaagcaggtcatgatatcggagcttttgttgggtgggatcttgca
catggcgcgggtaatattgaattaaaattacatgactgggatgtggattttgcatcttgg
tgcagttataagtatatgaatagtggtccaggaaatgcttctggctgctttgtacatgaa
cgatttcatgacagaaaagatattccacggttcgaaggttggtggggaactaaaaaagag
tctagatttttgatggaaccagagttcgaacccatgcctaatgcagatgcttggcaattg
agtaacgcaccaattttatcattagcgccgtatttggcttcactagaattatttgaaaaa
gttgggatggaagcacttattgaaaagcgaaatctcattgttgcttatttagaatttgtg
ttgaaatcaattgatttagaagtagaaagtactttcgaaataataactccttcgagtcaa
gaagaaagagggacacaactctctgtatttcttcatggagaaggaagaaagttgtttgat
tatttaatgaaaaatggagtaattacagattggagagaaccaaatgtaattagactagct
ccagcacctttttattgttcttatgaggatatgtacgagtttggtcaaattcttaagaaa
ggggtattgcaaaaagtataa

DBGET integrated database retrieval system