KEGG   Aquimarina sp. BL5: D1818_09000Help
Entry
D1818_09000       CDS       T05615                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
aqb  Aquimarina sp. BL5
Pathway
aqb00380  Tryptophan metabolism
aqb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    D1818_09000 (kynU)
Enzymes [BR:aqb01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     D1818_09000 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AXT50955
UniProt: A0A3A9VQZ6
LinkDB All DBs
Position
complement(2096592..2097890)
Genome map
AA seq 432 aa AA seqDB search
MQFENNREFAKKLDEQDPLKSYRSQFLFPKVNDKQVIYFTGNSLGLQPQNTKKYVDEVMK
DWAELAVEGHFYANKSWWDYHERMAKPLSKVVGAKPSEITVMNTLTVNLHLLMVSFYRPK
GKRYKIICEEKAFPSDQYMLQSQVRFHGYDPDDAIVEIKKRKGEHNFRIEDILSTIKSVG
EECALVLIGGVNYYTGQVFDMETITKAGHDVGAFVGWDLAHGAGNIELKLHDWDVDFASW
CSYKYMNSGPGNASGCFIHERFHDRKDIPRFEGWWGTKKESRFLMKPEFEPMPNADAWQL
SNAPILSLAPYLASLELFDEVGMDALIEKRNLIVAYLEFVLKEIDREVDSTFEIITPSNQ
EERGTQLSVFLHGEGRKLFDYLMKNGVITDWREPNVIRLAPAPFYCSYEDMYEFGQILKQ
GILGKKQSNALV
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcgaaaataatcgagaatttgctaagaaattagacgaacaagatccactgaaa
tcttatagaagccaattcctttttcctaaggtgaatgataaacaagtcatatattttaca
ggaaattctttaggactccagcctcaaaacacaaagaagtacgttgatgaagtaatgaaa
gattgggcagaacttgctgtagaaggtcatttttatgctaataagtcttggtgggattat
catgagcgaatggcaaaaccactaagtaaagtagttggtgctaaaccttcagaaattact
gtgatgaatacgctaacagtaaatcttcatttgttgatggtttcattctacagacctaag
ggaaaaagatacaagatcatctgcgaagaaaaagcttttcctagtgatcagtacatgtta
caaagccaggttcggtttcatggatatgatccagatgatgctattgtagaaattaaaaag
cgtaaaggagagcataattttaggatagaagatatcctctctacgatcaaatccgtcgga
gaagagtgtgccttagttttgataggtggagttaattattatacaggtcaggttttcgat
atggaaacaataaccaaagcaggtcatgatgtcggagcatttgtaggttgggatctagca
cacggagcaggtaatattgagctaaaacttcatgattgggatgtagattttgcatcttgg
tgtagttataaatatatgaatagtgggcctggaaatgcttcgggatgttttatacatgaa
cggtttcatgacagaaaagatattcctcgcttcgaaggctggtgggggactaaaaaggaa
tctaggtttcttatgaaaccagaatttgaaccaatgcctaatgcagatgcttggcaattg
agtaatgcgcccattttatctttagccccctatttagcctcgttagaattgtttgatgag
gttggtatggatgcgttaatagaaaagcgaaacctaattgtagcatatttagaatttgta
ctaaaagagattgacagagaagtagatagcacttttgaaatcattactccatcaaatcaa
gaagaacgaggaacacaactctctgtattccttcatggagaaggacgaaaattgttcgat
tatttgatgaaaaacggtgtgattacagattggagagaacctaatgtgatcagattagca
ccagctcctttttattgctcgtatgaagatatgtatgaatttggtcagatccttaaacaa
ggaattttaggaaaaaagcaaagcaatgctttagtttaa

DBGET integrated database retrieval system