KEGG   Aquimarina sp. BL5: D1818_15260Help
Entry
D1818_15260       CDS       T05615                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
aqb  Aquimarina sp. BL5
Pathway
aqb00240  Pyrimidine metabolism
aqb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    D1818_15260
Enzymes [BR:aqb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     D1818_15260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AXT52130
UniProt: A0A3A9WSL9
LinkDB All DBs
Position
complement(3683789..3684436)
Genome map
AA seq 215 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPAIDVRYDDEM
VVSHDANEIRSTPVPAAANIRILADTCDVVGIDEAQFFDDEIVSVCNDLANKGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLAQFSFRKSKKDDLVLLGETDEYEP
LSRAAYYKASLKEHVKEIEVTDPKELSKNSEKSNE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacggtaaatcataaagagcaatttgggtggatagaagttatctgt
ggttcgatgttttcgggtaagaccgaagaattgatccgcagactgaaacgcgcacagttt
gccaaacagaaagttgaaatttttaaaccagccatcgacgtgcgctatgatgacgaaatg
gttgtttctcacgatgcgaatgaaattcgttctactccggttccagcagccgctaatatt
agaattctagcagatacctgtgatgtggtaggcattgacgaggcacaattttttgatgat
gaaattgtaagtgtttgcaatgatttggctaataaaggtattcgtgtaatcgttgcagga
ttagatatggattttaaaggaaatccttttggacccatgccggcacttatggctactgca
gaatatgttaccaaagttcatgcggtttgtacccgaactggtaatcttgcccagtttagt
tttcgaaaatcaaaaaaagacgatttagtattactcggagaaaccgatgaatatgaaccc
ctaagtcgcgccgcttattataaagcttcactaaaagaacatgtaaaagaaatagaggtc
actgatcctaaagaattatctaaaaattctgaaaaatctaatgagtag

DBGET integrated database retrieval system