KEGG   Aquimarina sp. AD10: D1816_09315Help
Entry
D1816_09315       CDS       T05712                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
Organism
aqd  Aquimarina sp. AD10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 3HCDH_N 2-Hacid_dh_C ADH_zinc_N_2 Methyltransf_25 TrkA_N Methyltransf_11 F420_oxidored NADH_4Fe-4S ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AXT60539
UniProt: A0A3A9VLU3
LinkDB All DBs
Position
2241628..2242635
Genome map
AA seq 335 aa AA seqDB search
MKYIVCEQPGEFILKEKPSPTRKSNEALLKVKKVGICGTDLHAYSGNQAFFKYPRILGHE
LATEVLEIGENPRGIKAGDKVVIMPYVSCGTCIACRNGKTNCCTNIEVLGVHTDGGMQEE
ITVRTDLLLPANQLSHDEMAIVEPLAIGAHAIRRANLQPDEVVVVVGCGPIGIGIIKLAQ
IAGAKVIALDMNDGRLEYAKNEIGADYTVNVTNNPEQKISEITNGDMATVVFDATGHKKA
LETGPDYMAHGGRYVLVGLSKGELVFTHPKIHAKETTLMCSRNATLEDFEHVIHVLQKFP
TTSFITHNVPFTEMITNFDSWTKPETGVIKATVDF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattgtttgcgaacaacctggagagtttatcttaaaagaaaaacctagtcct
acacgtaaaagcaatgaagctttattaaaagtaaaaaaagtaggaatatgtggtacagat
ctacatgcatattctggtaatcaagctttttttaaataccctagaattttaggccatgaa
ctagcaacagaagtactagaaattggtgaaaatccaagaggcattaaagcgggagataaa
gtggtaattatgccttatgtaagttgtggtacatgcattgcttgtcgcaatggtaaaact
aattgctgcacaaatatcgaagtattaggtgttcatactgatggaggtatgcaagaagaa
ataacagtaagaacagatttattactacctgcaaatcaactatctcatgatgaaatggct
atcgtagaacctttagcaattggagcacatgctatacgcagagcgaatttacaacctgac
gaagttgttgttgtagtagggtgtggcccaatcggtattggaattatcaaattagcgcaa
atagcaggagctaaagtgattgctctggatatgaatgatgggcgcttagaatatgctaaa
aatgaaatcggagctgattatacggtgaatgttacaaacaatcctgaacaaaagatttcc
gaaatcacaaatggtgatatggctactgttgtatttgatgcaacaggtcataaaaaagca
ttagaaacgggtcctgattatatggcgcatggtggccgatacgtattagtaggactttct
aaaggcgaactcgtatttacccatcccaaaattcatgctaaagaaacaacattaatgtgt
agtcgtaatgctacattagaggattttgaacatgttatacatgtattgcagaaattccca
actacttcgtttattactcataatgttccttttaccgaaatgatcacaaattttgatagc
tggacaaaacccgaaacaggagtcattaaagcaactgttgatttctaa

DBGET integrated database retrieval system