KEGG   Aquimarina sp. AD10: D1816_10650Help
Entry
D1816_10650       CDS       T05712                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
aqd  Aquimarina sp. AD10
Pathway
aqd00380  Tryptophan metabolism
aqd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    D1816_10650 (kynU)
Enzymes [BR:aqd01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     D1816_10650 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AXT60788
UniProt: A0A3A9VDF8
LinkDB All DBs
Position
complement(2578441..2579724)
Genome map
AA seq 427 aa AA seqDB search
MHFENTREFAQKLDQKDPLKKYRDQFLFPKVNDKQVLYFTGNSLGLQPKNTRQFVNDVMK
DWEELAVEGHFYAQKPWWDYHERLANPLSKIVGAKPAEITVMNTLTVNLHLLMVSFYRPK
GNRYKIICEEKAFPSDQYMLQSQVRFHGYEPDDAIIEIKKRDGEHNFRTEDILKTIKEVG
DECALILIGGVNYYTGQVFDMKTITKAGHDIGAFVGWDLAHAAGNIKLDLHNWDVDFAAW
CSYKYMNSGPGNASGCFVHERFHNQKEIPRFEGWWGTSKETRFLMKPEFEPMANADAWQL
SNAPVLSLAPYLASLEMFDEVGMDAIIAKRNQIVAYLEYILKEIDEQVESSFEIITPSNQ
EERGTQLSVFLHGEGRKLFEYLMKKGVIVDWREPNVIRLAPAPLYCSYSDMYEFGQILKE
GILNKVS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcgaaaatactagagaatttgcccagaaacttgatcaaaaagatcccttaaaa
aagtacagggatcagtttctttttcctaaggtaaacgataaacaggtactatattttact
gggaattctttaggacttcaacccaaaaatacccgacagttcgttaatgatgtaatgaaa
gattgggaagaacttgcagtagaaggacatttttatgctcaaaaaccatggtgggattac
catgaacgtttagcaaatcctcttagtaaaatagtaggagcaaaacccgctgagattact
gtaatgaatacacttacggttaacctacatttattaatggtttctttctacagacctaaa
ggaaatagatataagatcatttgtgaagaaaaagcatttcctagcgatcagtatatgctt
cagagtcaagtgcgttttcatgggtatgagcccgatgatgctattatcgaaattaagaaa
cgtgatggggaacataattttcgaacagaagatattcttaagaccataaaagaagttgga
gatgaatgtgcattgatacttattggtggtgtaaactattataccggtcaggtctttgat
atgaaaacaattactaaagctggccatgatattggagcttttgtagggtgggatcttgcg
catgctgctgggaatattaaacttgacttgcataattgggatgtagattttgctgcttgg
tgtagttataaatatatgaatagtggacccggtaatgcttcgggatgttttgtgcatgaa
cggtttcataaccaaaaagaaatacctcgattcgaaggatggtggggtacaagtaaggaa
actagatttttaatgaaaccagagtttgaacctatggcaaatgcagatgcttggcaacta
agtaatgctccggtattgtctttggcaccatatctggcatctttagaaatgtttgatgag
gtaggaatggatgcgatcatagcaaaaagaaatcaaatagtagcatatttagaatatatt
ctcaaagaaatagatgaacaagtagagagttcatttgaaattattaccccttctaatcaa
gaagaaagagggacacaactatctgtgtttttacatggagaaggaagaaagttgtttgag
tatcttatgaaaaaaggagttattgtagattggagagaacccaatgtaattagacttgca
cctgcaccattatattgttcttacagtgatatgtatgaattcggacaaatattaaaagaa
ggtattcttaataaagttagttaa

DBGET integrated database retrieval system