KEGG   Aquimarina sp. AD10: D1816_17115Help
Entry
D1816_17115       CDS       T05712                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
aqd  Aquimarina sp. AD10
Pathway
aqd00240  Pyrimidine metabolism
aqd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    D1816_17115
Enzymes [BR:aqd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     D1816_17115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AXT62004
UniProt: A0A3A9VQD0
LinkDB All DBs
Position
complement(4154452..4155090)
Genome map
AA seq 212 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAKFAKQKVEIFKPAIDTRYDDEM
VVSHDSNEIRSTPVPAAANIRILANTCDVIGIDEAQFFDDEIVAVCNDLANQGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLAQFSYRKSTKDDLVLLGETEEYEP
LSRGAYYKAMLKEKVSKMDVKDPKEISKKSNE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcataaagagcaatttggttggatagaggtaatctgt
ggttctatgttttcgggcaagaccgaagaattaattcgcaggttaaaacgcgctaaattt
gcaaaacaaaaagttgaaatatttaaacctgcaatcgacacaagatatgacgatgaaatg
gtggtttctcatgattcaaatgagattagatcaactccagtaccagcagccgcaaatatt
agaatattagcaaacacgtgtgatgtgataggaatagatgaagctcaattttttgatgat
gaaattgttgctgtttgcaatgatttagcaaatcaaggaattagagtaattgttgctggt
ttggatatggattttaaaggcaatccttttggaccaatgccagcattaatggctaccgca
gaatatgttactaaagtacacgccgtttgcacaagaacaggaaacttggcacagtttagc
taccgcaaatctacaaaagatgatttagtcttactaggtgaaaccgaggagtacgaacct
ctaagtcggggagcatattataaagctatgctaaaagaaaaggtaagcaaaatggacgtt
aaagaccctaaggaaatatctaagaaatcgaatgagtag

DBGET integrated database retrieval system