KEGG   Aquaspirillum sp. LM1: BXU06_03455Help
Entry
BXU06_03455       CDS       T04696                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
aql  Aquaspirillum sp. LM1
Pathway
aql00020  Citrate cycle (TCA cycle)
aql00270  Cysteine and methionine metabolism
aql00620  Pyruvate metabolism
aql00630  Glyoxylate and dicarboxylate metabolism
aql00680  Methane metabolism
aql01100  Metabolic pathways
aql01110  Biosynthesis of secondary metabolites
aql01120  Microbial metabolism in diverse environments
aql01130  Biosynthesis of antibiotics
aql01200  Carbon metabolism
Module
aql_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aql_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aql_M00012  Glyoxylate cycle
aql_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aql00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BXU06_03455
   00620 Pyruvate metabolism
    BXU06_03455
   00630 Glyoxylate and dicarboxylate metabolism
    BXU06_03455
  Energy metabolism
   00680 Methane metabolism
    BXU06_03455
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BXU06_03455
Enzymes [BR:aql01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     BXU06_03455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AQR64216
UniProt: A0A1U9JJS6
LinkDB All DBs
Position
complement(771983..772963)
Genome map
AA seq 326 aa AA seqDB search
MKAPVRVAITGAAGQIGYALLFRIASGEMLGKDQPVILQLLDLPQAQAAVKGVMMELEDC
AFPLLAGMIASDDPNVAFKDADYAILVGARPRSKGMERKDLLEANGAIFTVQGKALNDHA
SRNVKVLVVGNPANTNAYIAMKSAPDLPAKNFTAMLRLDHNRALSQLAAKTGKAVADIET
MAVWGNHSPTMYADYRFATIGGESVKQMINDDAWNSDVFLPTVGKRGAAIIEARGLSSAA
SAANAAIDHVRDWALGTNGKWVTMGIPSDGSYGIPEGVMFGYPVTCANGEYTIVQGLEID
EFSRGRINITLNELEEERAGVAHLLG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcccccgttcgtgttgccatcactggtgctgctggtcaaattggttatgccctg
ctgttccgtatcgcctctggcgaaatgctcggcaaagaccagccggtgatcctgcaactg
ctggacctgccgcaagcccaggccgctgtgaagggcgtgatgatggaactggaagactgc
gccttcccgctgctggccggcatgatcgccagcgacgatccgaacgtggctttcaaggat
gccgactacgccatcctggtgggcgcacgtccgcgtagcaagggcatggagcgcaaggat
ctgctggaagccaacggtgccatcttcaccgtgcagggcaaggcgctgaacgaccacgcc
agccgcaatgtcaaggtgctggtggtgggcaacccggccaacaccaacgcctacatcgcc
atgaagtcggccccggatctgccggccaagaacttcaccgccatgctgcgcctggaccac
aaccgcgccctgtcgcaactggctgccaaaaccggcaaggccgtggccgacatcgaaacc
atggccgtgtggggcaaccacagcccgaccatgtacgctgactaccgctttgccaccatc
ggcggcgagagcgtcaagcaaatgatcaacgacgacgcatggaacagcgacgtgttcctg
ccgaccgtgggcaagcgcggtgccgccatcatcgaagcccgtggcctgtcctcggcggct
tccgccgccaacgccgccatcgaccacgtccgcgactgggcgctgggcaccaacggcaag
tgggtgaccatgggcattccgtccgacggttcctacggcattccggaaggcgtgatgttt
ggctacccggtgacctgcgccaatggcgaatacaccattgtgcaaggcctggaaatcgac
gagttcagccgtggccgcatcaacatcaccctgaacgagctggaagaagaacgcgctggt
gtggctcacctgctgggttga

DBGET integrated database retrieval system