KEGG   Aquaspirillum sp. LM1: BXU06_03975Help
Entry
BXU06_03975       CDS       T04696                                 

Definition
(GenBank) MarR family transcriptional regulator
Organism
aql  Aquaspirillum sp. LM1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HxlR HTH_Crp_2 HTH_34 HTH_24 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: AQR64307
UniProt: A0A1U9JJN5
LinkDB All DBs
Position
complement(897007..897543)
Genome map
AA seq 178 aa AA seqDB search
MPPTPPPAHDAVSVILQQWQQQRTDLDVSPMGPVGRLKRCAAHMQKRLDAVFAQHGLSSW
EFDLLATLRRSGEPYRLAPTVLFSSLMLTSGTMTRQLQQLEKRGLIQRQINPDDARSVLV
QLSADGLALIDSAVGEHVDNLHRLTAGLEAEELALLDRLLGKWMVGLEGEGGRALPRK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaccccacccccggcacacgacgccgtcagcgtcatcctgcagcaatggcag
cagcagcgcaccgacctggacgtcagcccaatgggcccggtaggccgactcaagcgctgc
gccgcccacatgcaaaaacgcctggacgccgtgtttgcccaacacggcctgagcagctgg
gaatttgacctgctggccaccctgcgccgcagcggagaaccctaccgcctggcccccacc
gtgctgttttcctcgctgatgctcacctccggcaccatgacccggcaactgcaacaactg
gaaaaacgcggcctgatccagcgccagatcaaccccgacgacgcccgcagcgtgctggtg
caactcagtgcagatggcttagccctgattgatagcgccgtgggtgagcatgtggacaac
ctgcaccggctgaccgccgggctggaggcggaggaactggcgctgttggatcggctgttg
gggaagtggatggtggggctggagggcgagggcggcagggcactgccgcgaaaatag

DBGET integrated database retrieval system