KEGG   Aquaspirillum sp. LM1: BXU06_13415Help
Entry
BXU06_13415       CDS       T04696                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aql  Aquaspirillum sp. LM1
Brite
KEGG Orthology (KO) [BR:aql00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BXU06_13415
Enzymes [BR:aql01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BXU06_13415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_3 DAO AlaDh_PNT_C Thi4 K_oxygenase NAD_binding_8 Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AQR65941
UniProt: A0A1U9JPD6
LinkDB All DBs
Position
3080906..3082471
Genome map
AA seq 521 aa AA seqDB search
MLDDTIQSQLKAYLERLQRPIELIASLDDSASSQEMHSLLTDIAALSDKVSLRTDGSNAR
RPSFAVAQPGETPRIHFAGLPMGHEFTSLVLALLQTGGHPPKVEQAVIDQIKALPGEFQF
ETFISLSCHNCPDVVQALNLMAVLNPGVTSTMIDGALFQDEVNARQIMAVPTVYLNGAEF
GQGRMSVEEVLAKVDTGASARAAAEIGQKAPFDVLVVGGGPAGAAAAIYAARKGIRTGVL
AERFGGQVMDTLGIENFISVKETEGPKLAMALEQHVKEYDVDVMNLQRATKLLPASQAGG
LIEVQLDNGAALKSRSVILATGARWREMGVPGEKDYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFADTLRADAVLQNKLNSLANVTVIKSAQTTEVTGDG
QKVNGLSYKDRVSEAIKHIELEGIFVQIGLLPATDWLKDSVELSRFGEIVIDAKGQTSVP
GVFAAGDCTTAPYKQIIIAMGSGATASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgataccatccagagccagctcaaagcctacctcgaacgcctgcaacgcccg
attgaactgattgccagcctggacgacagcgccagcagccaggaaatgcacagcctgctg
accgacatcgccgccctgtcggacaaggtcagcctgcgcaccgacggcagcaatgctcgc
cgcccgtcgtttgccgtggcgcagccaggcgaaaccccgcgcatccactttgccggcctg
ccgatgggccatgagttcacctcgctggtgctggcgctcttgcagaccggcggccaccca
cccaaggttgagcaggcggtgatcgaccagatcaaggcgctgccgggtgaattccagttt
gagacgtttatctcgctgtcctgccacaactgcccggacgtggtgcaggcactcaacctg
atggctgtgctcaaccccggcgtgaccagcaccatgatcgacggcgcgctgttccaggac
gaagtcaacgcccgccagatcatggcggtgcccacggtctatctcaatggtgccgagttt
ggccagggccgcatgagcgtggaagaagtgctggccaaggtggacaccggtgccagcgcc
cgtgccgctgccgaaatcggccagaaagccccgtttgacgtgctggtggtgggcggcggc
ccagcgggtgccgctgcggctatctacgctgcgcgcaagggcatccgcactggcgtgctg
gccgagcgctttggcggccaggtgatggacaccctgggcatcgagaacttcatctcggta
aaagaaaccgaaggccccaagttggccatggcgctggaacagcacgtcaaggaatacgac
gtggacgtgatgaacctgcaacgcgccaccaaactgctgcccgccagccaagccggtggc
ctgattgaagtgcagctggataacggcgcggcgctgaaatcgcgttcggtgattctggcc
accggcgcacgctggcgcgaaatgggcgtgcccggcgaaaaagactacaaagccaagggc
gtgtgtttctgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggtggcaactccggcgtcgaagcggccattgacctggccggcatcgtcagccacgtc
accctgctggaatttgccgacaccctgcgcgccgacgccgtgttgcagaacaagctcaac
agcctggccaacgtcaccgtgatcaagtcggcgcaaaccaccgaagtgaccggcgatggc
cagaaggtcaacggcctgagctacaaagaccgcgtcagcgaagcaatcaagcacatcgag
ctggaaggcatttttgtgcaaatcggcctgctgccggccaccgactggctgaaggacagc
gtggaactgagccgctttggcgaaatcgtcatcgacgccaagggccagaccagcgtgccc
ggcgtgtttgccgccggcgactgcaccaccgcgccgtacaagcagatcattatcgccatg
ggcagcggtgccaccgcctcgctgtcggcgtttgatcatctgatccgcacctcggccccg
gcctga

DBGET integrated database retrieval system