KEGG   Aquaspirillum sp. LM1: BXU06_13910Help
Entry
BXU06_13910       CDS       T04696                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
aql  Aquaspirillum sp. LM1
Pathway
aql00550  Peptidoglycan biosynthesis
aql01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:aql00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BXU06_13910
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BXU06_13910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aql01011]
    BXU06_13910
Enzymes [BR:aql01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BXU06_13910
Peptidoglycan biosynthesis and degradation proteins [BR:aql01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BXU06_13910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AQR66026
UniProt: A0A1U9JQ08
LinkDB All DBs
Position
complement(3202676..3204655)
Genome map
AA seq 659 aa AA seqDB search
MVSRFTAPQQADNQFQLRLLLAFAGMLLGFAILAGRFAWLQVYQHEHFATLAQNNSISLV
PIIPNRGLIVDRNGVVLAQNYSAYTLELTPYKIEDLSRTLDGLGQLVELGPRDIKRFRKQ
AEESRNFESIPLKIKLSDEEVARVSANIWRFPGVEVKARLFRDYPFKEITSHVVGYIGRI
NQKEQQALEDNDELADYRGSTHIGKTGLEYTYEKVLHGTAGFEEMETDAGGRAVRTLRRV
LPSNGHTLKLALDIELQKLAWDSFGDRRGALVAIDPSTGGVLAFVSKPGYDPNLFIDGID
SQSWKDLNEDWKKPLVNRALRGLYPPGSTFKPFMAMAALETKFREPSYTIPDPGYFSLPG
SSHRFRDSKPTGWGSMNMFRSIQVSSDTYYYKLAWDMGIDRLSPQLAKFGFGSQTGIDLD
GEARGVLPSKEWKRKRFAGKRYPEAARTWTPADVVPIGIGQGYNTYTPLQVAHAIAILAN
NGVVYQPHVVKEIENLKTGEVSKVAAAPVRDNHHNPANLAFVKSAMEAVLKPGGTAARIG
AGLSYTMAGKTGTAQVVQIKQGAKYNASALAEIHRDHSWFVAFAPVEAPKMAIAVIVENG
GWGAAAAAPIARELFDYYLTGRRSGVSSPDSPLVKPPRGATPSQADSSQAAGSAEEPVE
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctcgctttaccgccccgcagcaggcggacaatcagtttcagctgcgcctgctg
ctggcgtttgccggcatgttgctgggctttgccattctggccgggcgctttgcctggctg
caggtgtaccagcacgagcactttgccaccctggcacaaaacaacagcatctcgctggtg
ccgatcattcccaaccgtgggctgattgttgaccgcaatggcgtggtgctggcgcaaaac
tactcggcctacacgctggaactgaccccgtacaagattgaagacctcagccgcacgctg
gacgggcttggccaactggtcgagcttggcccacgggatatcaaacgctttcgcaagcag
gccgaggaaagccgcaatttcgaatcgattccgctgaaaatcaagctcagtgacgaagaa
gtggcccgagtgtcggccaatatctggcggtttccgggggtagaggtcaaggcgcggctg
ttccgcgattatccgttcaaggaaatcacctcgcatgtggtcggctatattggccggatc
aaccagaaagaacagcaggcgctggaagacaacgacgagctggctgattatcgcggcagc
acccacatcggcaaaaccgggctggaatacacctacgaaaaagtgctgcatggcaccgcg
ggttttgaagaaatggaaactgacgccggtggccgcgcggtgcgcaccttgcgccgggtg
ctgcccagcaatggtcataccctcaagctggcgctggatatcgagctgcaaaaattggcc
tgggacagctttggcgaccggcgcggcgcgctggtggccatcgaccccagcaccggcggc
gtgctggcgtttgtgtccaaacccggctacgaccccaatctgttcattgatggcatcgac
agccagagctggaaagacctgaacgaagactggaaaaaaccgctggtcaaccgcgcgctg
cgcggcctgtatccgccgggctccaccttcaagccgttcatggccatggccgcgctggaa
accaaattccgcgaacccagctacaccattcccgatccgggctatttttccctgccgggc
agcagccaccgcttccgcgactccaagcccaccggctggggcagcatgaatatgttccgt
tcaatccaggtgtcgtctgacacctactactacaagctggcctgggacatgggcatcgac
cggctgtctccgcaactggccaagtttggttttggcagccagaccggcatcgacctggat
ggcgaagccaggggggtgctgcccagcaaggaatggaagcgcaaacgttttgccggcaag
cgctacccggaagccgcccgcacctggacgccggcggatgtggtgccgatcggcattggc
cagggctacaacacctacaccccgctgcaggtggcgcacgccattgcgattctggccaat
aacggcgtggtgtatcagccgcatgtggtcaaggaaatcgaaaacctgaaaaccggcgaa
gtcagcaaagtggccgccgcgccagtgcgcgacaatcaccacaacccggccaatctggcc
tttgtgaaatccgccatggaagccgtgctgaaacccggcggcactgcggcgcggattggt
gccggcctgagctacaccatggccggcaaaaccggtaccgcccaggtggtgcagatcaag
cagggggccaaatacaatgcctcggcactggcagaaatccaccgtgaccactcctggttt
gtggcttttgccccggtggaggcgccaaaaatggcgattgcggtgattgtggaaaatggc
ggctggggtgccgccgccgccgcaccgattgcccgcgagctgtttgactattatctgacc
ggtcggcgcagcggcgtatccagcccggacagcccgctggtgaaaccgccgcgcggtgcc
acccccagccaggcggacagcagccaggctgccggctctgccgaggaacccgtggaatga

DBGET integrated database retrieval system