KEGG   Aquaspirillum sp. LM1: BXU06_13995Help
Entry
BXU06_13995       CDS       T04696                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
aql  Aquaspirillum sp. LM1
Pathway
aql00550  Peptidoglycan biosynthesis
aql01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:aql00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BXU06_13995
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BXU06_13995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aql01011]
    BXU06_13995
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aql03036]
    BXU06_13995
Enzymes [BR:aql01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BXU06_13995
Peptidoglycan biosynthesis and degradation proteins [BR:aql01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BXU06_13995
Chromosome and associated proteins [BR:aql03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BXU06_13995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AQR66038
UniProt: A0A1U9JPN3
LinkDB All DBs
Position
3219369..3221114
Genome map
AA seq 581 aa AA seqDB search
MAIVGATRHAPRPSPSVRLPPVRMRWVGLGLGLLFVALLGRAVYLQLVKQDFLQSQGAAR
YSRAIELEANRGVIADRNGEPLAISTPVQSIWASPADMEPVPADKINQLARLLEMDPAEV
SRKLSDKRREFLYIKRQISPDLADAVMKLGIPGIAKQQEFRRFYPDGEMTAHVVGVTGVD
GRGQEGLELAKEKMLAGKPGRRHVIKDRRGHIIEDIAAIERPRDGQTLSLSIDRKIQYLA
FRELKAAVETFKAKAGGVVVLDAHTGEVLALANLPSFNPNNRQRLDPAMKRNRALTDLFE
PGSTLKPFTVAKALDDGVVRTEQMFNTESYSIGPARIKDSHSHPQLAVWEIIQKSSNVGS
SKIALMLPPQTLWQLFDDVGFGRVPQTGFPGEATGRVRPYKTWKPIEQATMSYGHGISLS
LMQLARAYTIFTNDGVLMPVSFFRLDQAMPGKPVLKPDTARKMRDMLMTVTQPGGTAPRA
QVLGFNVGGKTGTAHKQEGRGYAASKYISSFVGFAPATRPRLIVAVMIDEPQGQYYGGTV
AGPVFSNVMAGSLRILGVEPDAPTNNTLIPLDNIPEVREET
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggccattgttggagccacccgccacgcccctcgccccagcccaagcgtgcgcctgcca
cccgtgcgcatgcgctgggtgggcctgggtctgggcctgttgtttgttgccttgctgggg
cgggcggtgtacctgcaactggtaaaacaggatttcctgcaaagccagggggccgcgcgc
tacagccgggcgattgaactggaagccaaccggggggtgattgccgaccgcaatggcgaa
ccgctggcaatttccaccccggtgcagtctatctgggccagcccggcggatatggagccg
gtgccggcagacaagatcaaccagttggcccggctgctggaaatggacccggcagaagtg
tcgcgcaagctgtcggacaagcgccgcgaatttttgtacatcaagcgccagatcagcccc
gacctggctgatgcggtgatgaagctgggcattcccggcattgccaagcagcaggagttc
cgccgcttttacccagacggtgaaatgaccgcgcatgtggttggcgtcaccggggtggat
ggccgtggccaggaaggcctggagctggccaaggaaaaaatgctggccggcaagccgggc
cgccgccatgtgatcaaggaccggcgcggccatatcatcgaagacattgccgccatcgaa
cgtccgcgcgatggccagaccctgtcgctgtcgatcgaccgcaagatccagtatctggcg
tttcgcgagctgaaagcggcggtggaaaccttcaaggccaaggccggcggcgtggtggtg
ctggatgcccacacgggcgaagtgctggcgctggccaatctgccctcgttcaacccgaac
aaccgccagcggctggatccggcgatgaagcgcaaccgggcgctgaccgacctgtttgaa
cccggctccaccctcaagccattcaccgtggccaaggcgctggacgatggcgtggtgcgc
accgagcagatgttcaataccgagagctacagcatcggcccggcgcgcatcaaggactcg
cacagccacccgcaactggcggtatgggaaatcatccagaaatccagcaacgtcggctcg
tccaaaattgccctgatgctgccgccgcaaaccctgtggcagctgtttgacgatgtcggc
tttggccgcgtgccacaaaccggcttccctggtgaagccactggtcgcgtgcgtccgtat
aaaacctggaaaccgattgaacaggccaccatgagctacggccacggcatttcgctcagc
ctgatgcagttggcccgtgcctacaccattttcaccaacgatggcgtgctgatgccggta
agctttttccggctggatcaggccatgcccggcaagccggtgctcaagccagacactgcg
cgcaagatgcgcgacatgctgatgacggtcacccagccaggcggcaccgcgccgcgcgcc
caggtgctgggcttcaacgtgggcggcaagaccggcaccgcgcacaagcaggaaggccgt
ggctacgccgccagcaagtatatttcctcgtttgttggctttgccccggccacccgcccc
cggctgattgtggcggtgatgattgacgagccgcagggccagtactacggcggcacggtg
gccggcccggtgttcagcaatgtgatggccggcagcctgcgcattctgggcgtcgagcct
gacgcaccaaccaataacaccctgattccgctggacaatattccagaagtgcgggaagag
acatga

DBGET integrated database retrieval system