KEGG   Aquitalea sp. USM4: DKK66_00600Help
Entry
DKK66_00600       CDS       T05865                                 

Definition
(GenBank) iron ABC transporter substrate-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
aqs  Aquitalea sp. USM4
Pathway
aqs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aqs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DKK66_00600
Transporters [BR:aqs02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    DKK66_00600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_1 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: QBJ76772
UniProt: A0A4P6TG16
LinkDB All DBs
Position
127500..128510
Genome map
AA seq 336 aa AA seqDB search
MSRPFARITTALLLSSLFAATAHAAPSAEGIVVYNAQHESLTKSWVEGFTKETGIKVTVR
NGSDSEMGNQIVQEGAASPADVFLTENSPAMVLVDNAKLLAPLSPATTAQVDPAFRPAHG
RWVGIAARSTVFVYNKNRLTPKELPKSMLDLAKPEWKGRWGAAPAGADFQAIVSALLEQK
GEAATLAWLKAMKTNAQPYKGNSVVMKAVNASQIDGGVIYHYYYFGDQNKTGENSKNTAL
HYFKQQDPGAFVSISGGAVLASSKHKEEAQAFLKWVTGKGGQNILRTENSFEYAVGQGAQ
SNPKLVPLKDLDAPRIDASRLNSRKTVELMTQAGLL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtccatttgcccgcatcaccaccgccctgctgctgtccagtctgtttgccgcc
accgcacatgccgcccccagtgccgaaggtatcgtggtgtacaacgcccagcatgagagc
ctgaccaaatcctgggtggaaggctttaccaaggaaaccggcatcaaggttaccgtgcgc
aatggtagtgacagcgaaatgggcaaccagatcgtgcaggaaggcgcagcctcgccggcg
gatgtattcctgaccgaaaactccccggccatggtgctggtggataatgccaagctgctg
gccccgctgtccccggccaccaccgctcaggtagacccggccttccgtcccgctcatggc
cgctgggtaggcattgccgcccgctccaccgtttttgtctacaacaagaaccgcctgact
ccgaaagagctgcccaagtccatgctggacctggccaaaccggaatggaaaggccgctgg
ggcgcagcaccggccggtgccgacttccaggcgattgtgagtgccttgctggaacaaaag
ggtgaagccgccacgctggcctggctgaaagccatgaagaccaacgcccaaccctacaag
ggcaacagcgtggtgatgaaagcggtgaatgccagccagatcgacggcggggtgatttat
cactattactacttcggcgatcagaacaagaccggcgaaaacagcaagaacaccgccctg
cactacttcaagcagcaagacccgggtgcgtttgtcagcatctccggcggtgcggtgctg
gcttccagcaagcacaaggaagaggcccaggccttcctgaagtgggtgaccggcaagggt
ggccagaacatcctgcgcaccgaaaattcgtttgaatatgcagtcggccagggcgcgcag
tccaatcccaagctggttccgctgaaggatctggacgcacccaggatcgacgcttcccgc
ctgaacagccgcaagacggtagaactgatgacacaggcaggtttgctgtaa

DBGET integrated database retrieval system