KEGG   Aquitalea sp. USM4: DKK66_04655
Entry
DKK66_04655       CDS       T05865                                 

Definition
(GenBank) two-component system sensor histidine kinase RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
aqs  Aquitalea sp. USM4
Pathway
aqs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aqs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DKK66_04655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aqs01001]
    DKK66_04655
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:aqs02022]
    DKK66_04655
Enzymes [BR:aqs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DKK66_04655
Protein kinases [BR:aqs01001]
 Histidine kinases
  OmpR family
   DKK66_04655
Two-component system [BR:aqs02022]
 OmpR family
  RstB-RstA
   DKK66_04655
SSDB
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_2
Other DBs
NCBI-ProteinID: QBJ77459
UniProt: A0A4P6THY8
LinkDB
Position
990844..992115
AA seq 423 aa
MRRLFIQFYLLLVTCFMVAVVMVGAVYKQAVDDVGERYLSDLLRTTLSLIEADLHGVPED
RWTETLQSSNHDFTFKVTVEKQSNYLLDEESEEALNNGEIVMLEDKYLFLQKIEDSNYLL
VAGPLRYLFFLHQLKSVDYALLALLGLSLAIPVFLWMQPHWKDLVTLEKTAGKLAGGDFS
ARVHLPSRSGVRQVGVAFNHMADSIAALLASKKALTNAVAHELRTPLARLRYRLALLEGD
EDSPAKKAIEKDLSAIDSLVEELLFHAKLDRPEAPLQLTQFDAVSWARERIHEQATLAPE
LNWLEPAEETLNFLADQYLVTRALDNFLSNARRYAKSTIQTTLRMEDRNCIIMVDDDGPG
IPAEDRDRVFDPFIRLDESRGRKTGGHGLGLAIVAGIARLHHGEVKVETSPLGGARFIIR
WPT
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgcgtcgtctgttcatccagttttacctgctgctggtcacctgcttcatggtggcggtg
gtcatggtgggtgcggtttacaaacaggcagtggacgatgtgggtgagcgctatttgtca
gacttgctgcgcaccaccctgtcgctgatcgaagccgacctgcacggcgtgccggaagat
cgctggaccgaaaccctgcaaagctccaaccatgactttaccttcaaggtgacggtggaa
aagcagagcaactacttgctggatgaagaatcggaagaagccctcaacaatggcgaaatc
gtcatgctggaggacaagtacctgttcctgcagaagatagaggacagcaattacttgctg
gtagccggccccttgcgctacctgttcttcctgcatcagctcaagtcggtggattacgcc
ttgctggccttgctgggtttgtcactggccattccggtgttcttgtggatgcaaccgcac
tggaaagacctggtcaccctggaaaaaactgccggcaaactggctggcggtgatttttcc
gcccgggtgcatttgcccagccgttccggtgtacgccaggtcggtgtggcgttcaaccat
atggcagacagcattgccgccctgctggccagcaagaaggcactgaccaatgcggtggcg
cacgaactgcgcaccccgctggcacgcttgcgctaccggctggccctgctggaaggcgat
gaggactccccggccaagaaagccatcgaaaaagacctgtccgccattgactcgctggta
gaagaactgctgtttcatgccaagctggaccggccggaagcaccgttgcagctgacgcag
tttgatgccgtcagctgggcacgcgagcgcattcatgagcaagccacgctggccccggaa
ctgaactggctggaaccggcggaagaaacgctgaactttctggctgaccagtatctggtc
acccgcgcgctggacaacttcctgtccaatgcacggcgctatgcaaagagcacgatccag
accacgctgcgcatggaagaccgcaactgcatcatcatggtggacgatgacggcccgggt
attccggcagaagaccgggaccgggtgttcgaccccttcatccggctggatgaaagccgt
ggccgcaagaccggtggccacgggctggggctggccattgttgccggcattgcgcggctg
caccatggcgaggtgaaagtggaaacctcgcccttgggtggcgcacgcttcattattcgt
tggccaacatga

DBGET integrated database retrieval system