KEGG   Aquitalea sp. USM4: DKK66_08475Help
Entry
DKK66_08475       CDS       T05865                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aqs  Aquitalea sp. USM4
Brite
KEGG Orthology (KO) [BR:aqs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DKK66_08475
Enzymes [BR:aqs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DKK66_08475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 DAO FAD_oxidored HI0933_like FAD_binding_2 FAD_binding_3 NAD_binding_8 Glutaredoxin NAD_binding_7 Thi4 K_oxygenase FMO-like NAD_binding_9 AlaDh_PNT_C baeRF_family10
Motif
Other DBs
NCBI-ProteinID: QBJ80254
UniProt: A0A4P6TMW1
LinkDB All DBs
Position
1779975..1781525
Genome map
AA seq 516 aa AA seqDB search
MLDTTIKTQLTAYLEKLQQPIELIASLDDSAKAQEMFSLLQDIASLSPKVTLNSNGQAAR
RPSFAIARPGEAGRIEFAGIPMGHEFTSLVLALLQTGGHPPKVDEDTIAQIRGLQGSYQF
EVFVSLSCHNCPDVVQAVNLMAVLNPNVRSVMIDGGVFQQEVTDRQIMGVPAIYLNGEQF
GSGRMGLEEIIAKLDTGAVAREAEKIAAKEAFDVLIVGGGPAGAAAAIYAARKGIRTGVV
AERFGGQVLDTLAIENFISVQETEGPKLAMALEQHVKSYDVDVMNLQRAAALKPAQNGQL
AEVTLESGAVLKSKAVIVATGARWREMNVPGEAEYRAKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVTHVTLLEFGDSLRADAVLQKKLHSLPNVRVITNAQTTEVTGDGQ
KVNGLSYQERITGETHHVALEGIFVQIGLLPNTDWLKGSVALSPRGEIEVDAKGQTSAEG
VFAAGDATTAPYKQIIIAMGEGAKASLSAFDYLIRS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaccatcaagacccaactgaccgcctacctggaaaaactgcagcagccg
atcgaactgattgccagcctggatgacagcgccaaggcgcaggaaatgttcagcctgttg
caagacatcgccagcctgtcgcccaaggtaacgctgaacagcaatggccaggccgcgcgt
cgcccgtcttttgccattgcccgtccgggcgaagctggccgtatcgagtttgccggcatc
ccgatgggccacgaattcacctcgctggtgctggccctgctgcagaccggtggccatccg
cccaaggtggacgaggacaccattgcccagattcgcggcctgcaaggcagctaccagttt
gaagtgtttgtctcgctcagctgccacaactgcccggacgtggtgcaggccgtcaacctg
atggcagtgctcaaccccaatgtacgtagcgtgatgattgatggcggtgtgttccagcag
gaagttaccgaccgccagatcatgggcgtgccggccatctacctgaatggcgaacagttt
ggcagtggccgcatgggcctggaagaaatcatcgccaagctggataccggtgccgtggca
cgtgaagcagagaagattgccgccaaggaagcattcgacgtgctgatcgtcggcggtggc
ccggccggcgctgctgccgccatctatgcggcgcgcaagggcatccgtaccggtgtggtg
gccgagcgtttcggcggccaggtgctggatacgctggcgattgaaaacttcatctcggtg
caggaaaccgaagggccgaagctggcgatggcgctggaacaacacgtcaaatcctatgat
gtggacgtgatgaacctgcaacgcgctgctgcgctcaaaccggcgcaaaacggccagctg
gccgaggtgacgctggaaagcggtgccgtgctcaagagcaaggcggtgattgtggccacc
ggtgcgcgctggcgcgaaatgaatgtgccgggcgaagccgagtaccgcgccaagggcgtg
gcttactgcccgcactgcgatggtccgttgttcaagggcaagcgtgtcgcggtgattggc
ggcggtaactctggcgtggaagccgccatcgacctggccggcatcgtcacccatgtcacc
ctgctggagttcggcgacagcttgcgtgccgatgcggtgttgcagaagaaactgcacagc
ctgcccaatgtgcgcgtcatcaccaatgcccagaccaccgaagtgaccggtgatggacag
aaggtgaatggcctgagctatcaggagcgcattaccggggagacccaccatgtggcgctg
gaaggcatttttgtgcagatcggcttgctgcccaataccgactggctgaaaggcagcgtt
gccctgtcgccgcgcggtgaaatcgaagtggatgccaagggccagacttcggctgaaggc
gtgtttgctgccggtgatgccaccacggcaccgtacaagcagatcatcatcgccatgggc
gaaggtgccaaggccagcctgtccgcctttgactacctgatccgcagctaa

DBGET integrated database retrieval system