KEGG   Amphimedon queenslandica (sponge): 100631589Help
Entry
100631589         CDS       T02284                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein kinase Fer-like
  KO
K07364  tyrosine-protein kinase Tec [EC:2.7.10.2]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aqu01001]
    100631589
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100631589
Protein kinases [BR:aqu01001]
 Non-receptor tyrosine kinases
  TEC family
   100631589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Baculo_PEP_C
Motif
Other DBs
NCBI-GeneID: 100631589
NCBI-ProteinID: XP_019860358
LinkDB All DBs
Position
Unknown
AA seq 849 aa AA seqDB search
MDRAQLQPLLLPDLKETGKELGRGAYGVVTEVIVSGTICAAKKLHPAIVQGHTLRRFGDE
VLLHSQQRHPNIVQLIGVYYPSHSQLPMLVMEYLPLSLTQCLERAEELPLQMKYSILLDV
AKGLCYLHGKRPPIVHRDLTANNVLLTSSYSAKISDLGVSRLADTFKKHHLTTAPGNAMV
MPPEALEDNPVYDHKLDVFSYGCLILHVLTGQFPQPTNQFVQEPGRSSFLMVSEWDRRSS
YIEDIPKENELLPLAKDCLTDESTGRPEMIECYQFVEQILSKYPKMKSATELMKDNEAAE
KRICELDAEIKELKAEKIEKDKLEKQLTADNERLTGNYDQLNKKLKNILSQVTGLQNAHS
LKEKEFNDSTRVLKEIIRSRDEQLVKQQEDNMELLKKREADLKEEHLIELAAMKEESEAK
LLSATKKHDQQLSEVREECEVKVAEVVKEFMESSQTLKDTAAQQQSTPMTVGRNEAFITN
SYFIKAGLESEIWFFPKLSRARAENILKQENKEGAFVVRISSQEKHYTLSICHKGQAMHY
LIRIDEEKKYYIYNMHRFPTVTELIEYHKLNGGGLPTRLRQPPALLVPNQPALRVSSAFD
DKWRIDKSELSLGKELGSGQFKRVVAGQWRNEVDVAIKIMEGALNEDDLIKEAILMQKFQ
HDNLVKLCGVCIRQRSVYIITELMVNGSLLQYLCNNQRLVNKTDILLDMAIQICATMKFL
EQSGFIHRNLPARNCQVGYSNIVKVGGFSSARFVPDDEYEASVGVKYAVRWSPPEVITHA
RYSSKXDVWSYDILLWELWSGSNNPYPAFSNIQVLDQIERGYRLEKPKLCPYKVYALMRR
SWRIGKRCI
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggacagggctcaactccagccattactattgcctgatttaaaggagactggtaaagag
ttaggtcgtggagcttatggtgttgttactgaagtaatagttagtggaacaatctgtgct
gctaagaagctccatcctgctattgtacaggggcacactttgagaagatttggtgatgag
gtgcttcttcacagtcagcaaaggcatcctaacattgtccagttaattggtgtctattat
ccttctcattcacaattaccaatgttagtaatggagtatcttcctttatcactcacacaa
tgtctggagagagcggaagagctaccacttcaaatgaagtattctattcttcttgatgtt
gctaagggtttgtgttatcttcatggtaaacgtcctcctattgtacatcgtgacctcact
gctaataacgtgttactcacctcttcatactcagctaagatatcagatctaggagtatca
agattagctgatacctttaaaaagcatcacctcactacagcacctggtaatgctatggta
atgccaccagaagctcttgaagataatccggtatatgatcacaagttagatgtattctct
tatggttgtctcattcttcatgtacttactggtcaattccctcaaccaaccaaccaattt
gtacaagaacctggtagatcatccttcttaatggtatcagaatgggatagaagatcaagt
tatattgaagatataccaaaagaaaatgagctccttcctttagcaaaggattgtctcact
gatgagtctactggaagaccagaaatgattgagtgttatcaatttgtggaacaaattcta
tcaaaatatccaaaaatgaaaagtgcaacagaattaatgaaagataatgaggcagcagaa
aaacgtatttgtgaattagatgcagaaattaaagaattgaaagctgagaaaattgagaaa
gacaaacttgagaaacaactgacagcagataatgaacgactgacaggaaactatgaccaa
ctaaataaaaaactgaaaaatattttatctcaagtgacgggcctacaaaatgctcattca
ttgaaagaaaaggaattcaatgattccactcgagtgctaaaggaaattattagaagcaga
gatgaacagctagttaagcaacaagaagacaacatggaactactgaagaaaagagaagct
gatttaaaggaagagcatttgatagagcttgctgcaatgaaggaggagtctgaagcaaag
cttttgtctgcgacaaagaaacatgatcagcagctttctgaagtacgtgaagaatgtgaa
gtcaaagtagcagaagtagtgaaggagtttatggagtcaagtcaaacacttaaagataca
gcagcacagcagcagtccacccctatgacagtaggcagaaatgaagcatttattactaac
agctactttataaaggctggcttagaaagtgaaatttggtttttccctaaattatcacgt
gccagagctgagaatatactcaagcaagagaataaagaaggagcctttgttgttagaatt
tccagtcaagaaaagcactataccctatcaatatgtcataaaggtcaagccatgcattat
cttattagaattgatgaagagaagaaatattacatatataatatgcatcgttttccaaca
gttacagaacttattgaatatcacaaactgaatggaggaggtttgcctaccagattaaga
caaccccctgctttgttggtccctaatcaaccagctctcagagtctcatctgcatttgat
gataaatggcgaattgataaatctgagctgtcattaggtaaagaactaggtagtggacag
tttaaaagggtagtagcaggtcagtggcgtaatgaagttgatgttgctattaaaataatg
gaaggtgcactgaatgaagatgacttgatcaaagaagcaatattgatgcagaaatttcaa
catgataatttagtaaagttatgtggagtgtgtatcagacaaagatctgtttatatcatc
actgaattaatggttaatggttctctactccagtatctttgtaataatcaacgtttagta
aataagacagacattttacttgacatggctatacagatttgtgctactatgaagttttta
gaacaatctggttttatacacagaaatttgcctgctaggaactgtcaggttggttatagc
aatattgttaaagttggtggttttagttcagcaagatttgttcctgatgatgagtacgaa
gcatctgtaggtgtcaagtatgctgtcagatggtcaccacctgaagttatcactcatgct
agatatagcagcaaataagatgtttggtcatatgatattttgttgtgggagttgtggagt
ggtagcaataacccttacccagccttcagcaatattcaagtattagatcaaattgaacgt
ggctatcgactagaaaagcctaaattatgtccttataaagtttatgccttaatgagaagg
agttggcgcattggcaagcgttgcatttaa

DBGET integrated database retrieval system