KEGG   Amphimedon queenslandica (sponge): 100631759Help
Entry
100631759         CDS       T02284                                 

Definition
(RefSeq) probable aspartate aminotransferase, cytoplasmic
  KO
K14454  aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00220  Arginine biosynthesis
aqu00250  Alanine, aspartate and glutamate metabolism
aqu00270  Cysteine and methionine metabolism
aqu00330  Arginine and proline metabolism
aqu00350  Tyrosine metabolism
aqu00360  Phenylalanine metabolism
aqu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aqu01100  Metabolic pathways
aqu01200  Carbon metabolism
aqu01210  2-Oxocarboxylic acid metabolism
aqu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100631759
   00270 Cysteine and methionine metabolism
    100631759
   00220 Arginine biosynthesis
    100631759
   00330 Arginine and proline metabolism
    100631759
   00350 Tyrosine metabolism
    100631759
   00360 Phenylalanine metabolism
    100631759
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100631759
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aqu01007]
    100631759
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aqu04131]
    100631759
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aqu04147]
    100631759
Enzymes [BR:aqu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     100631759
Amino acid related enzymes [BR:aqu01007]
 Aminotransferase (transaminase)
  Class I
   100631759
Membrane trafficking [BR:aqu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100631759
Exosome [BR:aqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100631759
  Exosomal proteins of other body fluids (saliva and urine)
   100631759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 ILEI
Motif
Other DBs
NCBI-GeneID: 100631759
NCBI-ProteinID: XP_003390731
UniProt: A0A1X7TDJ6
LinkDB All DBs
Position
Unknown
AA seq 316 aa AA seqDB search
MSSPTSVFDGMEAAPPDAVFNVLAKYNEDTFPKKVNLSVGAYRDEEGQPWVLPVVKTIET
QMTSDVMLNHEYLPIDGLKSFTESATRLVLGSDGPAVTQNRYCSIQCLSGTGSILAALEL
IRKFLEIDTIYLSNPTWSNHRGIASNTGFTQIREYRYFDTTTRGLDIEGMIEDLKSATEG
SAVILHTCAHNPTGVDPSKEEWKRIFEALKERSLFPVMDTAYIGFASGDIDADSWPLREM
DRQGMEFCITQSFSKNFGLYNERVGQLCCVLTSPEMAGVMLTQLKVIARRLWSNPXXHGA
RIVATALNNSTLYQEW
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctccaacctcagttttcgatggcatggaagcagctcctcctgacgctgtattc
aacgtactggctaaatataacgaggacaccttccccaaaaaagtcaacctatcagttggc
gcttacagggatgaagagggccagccctgggtactgcccgttgtaaagacaatagagaca
cagatgacctctgatgtgatgctcaatcatgagtacctccccattgatggactcaagtca
ttcactgaatctgcaacaagacttgtactgggatcagatggaccagctgtaacgcaaaac
agatactgttctattcagtgtttatctggtactggtagcatccttgcagcattggagctc
atcaggaaattccttgaaattgacacaatttatttatctaatccaacttggtctaatcat
cgtggtattgctagcaacactggctttactcaaattagagaatatcgttactttgataca
accaccagaggacttgatattgagggcatgattgaagacttgaagtctgctactgaggga
tcagctgtgatactacacacttgtgcccataatcctacaggagttgatccttcaaaggaa
gaatggaagaggatctttgaagcactcaaggagaggagcctatttcctgtaatggataca
gcatacattggatttgcttctggtgacattgacgctgactcatggccactgagagagatg
gatagacaaggaatggagttctgtattactcagtctttctctaaaaactttggactctac
aatgagagagtgggtcaattgtgctgtgtcctgacaagtccagaaatggcaggagtcatg
ttgacacagctcaaagtgatagcaaggaggctttggtctaacccancanaccatggagca
aggattgtagctactgctttaaacaactcaacactgtaccaggaatggtga

DBGET integrated database retrieval system