KEGG   Amphimedon queenslandica (sponge): 100632187Help
Entry
100632187         CDS       T02284                                 

Definition
(RefSeq) histone deacetylase 6-like
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:aqu01009]
    100632187
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:aqu03019]
    100632187
   04131 Membrane trafficking [BR:aqu04131]
    100632187
   03036 Chromosome and associated proteins [BR:aqu03036]
    100632187
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100632187
Protein phosphatases and associated proteins [BR:aqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100632187
Messenger RNA biogenesis [BR:aqu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100632187
Membrane trafficking [BR:aqu04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100632187
Chromosome and associated proteins [BR:aqu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100632187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 100632187
NCBI-ProteinID: XP_003382755
UniProt: A0A1X7VVD8
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MEREKIVTREPSDLFDWNLASRKKDVRRKSSFTSQCVMTGIVYDERMKNHRNDNNPNHPE
CPERISSIWEQLVDDGVVECCRRIDARSATEQEILYVHSKTHYDEMVATENMSLEKLFQR
ALRLNSIYINPSSMQCALLAAGSVCEVTKLVIDETVDNGVAIVRPPGHHAESYTSMGFCF
FNNVAIAAKMAIEEYGVKRILIIDWDVHHGNATQHMFYDDNRVLYVSLHRHDNGGFYPGG
DEGDYDKVGKGKGSGYNVNIPWNLARMGDAEYMSAFYQIIMPIAFEYQPELVIVSSGFDS
GEGDPIGGYRVTPNGYAHMTHQLKSLADGKIVVALEGGYNLTTISHSMSAVVQVLLGDTP
RSLESCVPNDSALASIGNAAKCLSKYWKSLRHWQDQPVKGTVEEFAPLTSSSVVDPAPLT
DDSMSNSQADEMRGDDSIIIENGETPKSKPMPDESLKRSDEEILSEPPPPGTIPISSDSI
PLDVAQKALIQQLEDEGNACMFAVNPLSWCPHLESIVPIEGSLDTSALCETCSTPRENWV
CLTCQHVHCGRYINKHMLEHSEASGHNIVLSYADLSVWCFTCDSYVYNPVLFPFIKLASD
DKFK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggaaaagattgtaactagagaaccaagtgacttatttgactggaatctcgcc
agcaggaagaaagatgtaaggagaaagagttccttcactagccaatgcgttatgacgggt
attgtatatgacgagcgaatgaagaatcacaggaacgacaataatccaaatcatcctgag
tgccccgagaggattagctccatatgggaacagttggttgatgacggtgtggttgagtgc
tgtaggagaatagatgctagatctgccaccgagcaagagatattatatgttcacagtaaa
actcattacgatgaaatggtagcaactgagaacatgtctttggagaaattatttcaacga
gctcttcgtctcaattctatttatataaatccatcttcaatgcagtgtgctcttcttgct
gctggctctgtatgtgaagttacaaagctagtgattgatgaaactgttgataatggggtt
gctatagtgaggccgcctggtcatcatgcagagtcctacacgtcaatgggtttctgtttc
ttcaataatgtagccatcgctgccaaaatggctattgaagagtatggagtcaagaggatt
ctcattattgactgggatgttcatcatggcaatgcaacacagcacatgttctatgatgac
aacagggtcttgtatgttagtcttcatcgtcacgataacggtgggttctaccctggtggt
gacgaaggtgactatgataaagttggcaaaggcaaaggctccggctataatgtcaacata
ccttggaatctggctaggatgggtgatgccgaatacatgagtgccttctatcagatcata
atgccaattgcatttgagtaccagccagagcttgtaatagtttcgtcaggttttgattct
ggtgaaggagacccaataggaggttatagggttactcctaatgggtatgctcacatgacg
catcaattgaaatctctcgcagacggaaagattgttgtagctcttgaaggtgggtataat
ctcaccactatatcgcactcaatgtctgctgttgtgcaagttcttttgggcgacacacca
cgttcacttgagtcctgtgttcctaatgatagtgctcttgcttctattggtaatgctgca
aagtgtttatcaaaatactggaaatcactcagacactggcaagaccagccagtaaaaggg
acagtggaagagtttgctccattaaccagtagcagtgtagtagatccagcaccactgact
gatgatagtatgagcaacagtcaagcagatgaaatgagaggagatgattccattataatt
gagaatggtgagacccccaagtctaaacccatgccggacgaaagcctaaaaagaagcgat
gaagaaatactctcggagcctccacctcctggcactatccccatatcctctgactccata
ccattggatgtagcacagaaagcattaatacaacaactggaggatgaaggaaatgcctgt
atgtttgctgttaatccattgtcctggtgtcctcacttggagtccatagtaccaatagaa
gggtcgctggacacgtctgcattatgtgagacgtgtagtacaccacgtgagaactgggtc
tgtctcacctgtcagcatgtgcattgtggacgatacattaataagcatatgctcgagcac
agtgaagcttctggacacaatattgtattgtcgtatgctgatctttctgtttggtgtttc
acttgtgattcttacgtttataatcctgttctcttcccatttatcaaattggcaagtgat
gacaaatttaagtag

DBGET integrated database retrieval system