KEGG   Amphimedon queenslandica (sponge): 100632409Help
Entry
100632409         CDS       T02284                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00020  Citrate cycle (TCA cycle)
aqu00190  Oxidative phosphorylation
aqu01100  Metabolic pathways
aqu01200  Carbon metabolism
Module
aqu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aqu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aqu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100632409
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100632409
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100632409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 100632409
NCBI-ProteinID: XP_011403424
LinkDB All DBs
Position
Unknown
AA seq 666 aa AA seqDB search
MIITYCYLWAWFKMAAVRALLTRSLKIPRTLKRNPFHSSAAKQNNTAKVSRKGQYQIIDH
TYDAIVVGAGGAGLRAAFGLSSQGFKTACITKLFPTRSHTVAAQGGINAALGHMEEDNWK
WHMYDTVKGSDWLGDQDAIHYMTEEAPRTVIELENYGMPFSRLEDGRIYQRAFGGGSLNY
GKGGQAHRCCCVADRTGHSLLHTLYGQSLRFNTEYFIEYFALDLIMEEGECRGVVAMNME
DGSIHRFKALNTVLATGGYGRVYFSCTSAHTCTGDGTAMITRAGLANEDMEFVQFHPTGI
YGAGCLITEGSRGEGGYLLNSEGERFMERYAPSAKDLASRDVVSRSITIEIREGRGCGPD
KDHVYLQLSHLPPEVLASRLPGISETAQIFAGVDITREPIPVLPTVHYNMGGVPTNYKGQ
VIQYDESKGGDYIIPGLYSAGEAACASVHGANRLGANSLLDIVVFGRAAALTIAEECTPG
QTVPNISESTGESSIDNIDTLLHNETATIPTSELRLNMQKVMQNNAAVFRTGPVLEEGIE
KLTSLAGDMRNVKVHDKGLVWNTDLVETLELQNLMLNGLQTVASAEARKETRGAHAREDF
KDRVDEYDYKLPLEGQDKLDVKDHWRKHTLSSMPSDSEVKLDYRPVIDETLNENDCPSVP
PTIRVY
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgattattacatattgttacttgtgggcgtggtttaaaatggcggctgttagagctctc
ctcactcggagcctaaaaataccaaggacactgaaaaggaatccttttcattcttcagcc
gctaaacagaacaatacagctaaagtatctcgtaaaggccaataccaaatcattgatcat
acttatgatgctattgtggttggggcaggaggggcggggcttagagcggcctttggtctc
tcctcacaaggtttcaagacggcctgcatcactaaactgttccctactcgctcgcacact
gttgctgctcaaggtggcatcaatgccgccttaggtcacatggaagaagacaattggaag
tggcatatgtacgatacagtgaaaggatccgactggttgggggatcaagacgccattcac
tacatgacagaagaggcaccaaggacagtcattgaattggagaattacggtatgcccttt
agtagacttgaagatggtcgtatttatcaaagagcctttggaggaggtagcctgaactat
ggtaaaggagggcaggctcaccgctgctgctgtgtggctgatagaactggccactcactc
ctccacactttatacggacaatcgctgcgtttcaatactgagtacttcattgagtatttt
gctcttgatctgataatggaggaaggagagtgcaggggagtggtagctatgaatatggag
gacggatctatccatcgtttcaaagcacttaacactgttctggccactggtggttatggt
agagtgtatttctcctgtacttcagctcatacttgtactggagatggaactgcaatgatc
actagagctggtctggccaatgaagacatggagtttgtacagtttcatccaacaggtatt
tatggtgctggttgtctcattacggagggtagcagaggggagggcgggtacctattgaac
agtgagggtgagaggtttatggagagatatgccccgtcagcaaaagaccttgcgtctaga
gacgtcgtgtctcgttctataactattgaaattagggaaggaagagggtgtggccctgat
aaagatcacgtatatttgcaactgtcacatcttccaccagaagttttagcctctcgtctc
cccggtatctcagaaactgctcaaatatttgctggagttgacatcacgagggaaccaatt
cccgtccttcccactgttcattacaatatgggtggagtccccactaattacaagggacag
gttatacagtatgatgagtccaagggcggggattacatcatacctggtctctattcagct
ggagaggcggcctgtgcttcagttcatggagccaatagattgggggctaattcactcctg
gatattgtagtgtttgggcgagcagctgctcttactatcgctgaagaatgtacacctggt
cagactgtccctaatattagcgagagcactggtgagtcctccattgataatattgatact
ctccttcacaatgagaccgctaccattcctacttcagagcttagactcaacatgcaaaag
gtaatgcagaataatgcagctgtatttcggactggcccagtactggaggaaggtattgag
aagctcacctctcttgctggcgacatgaggaatgtgaaggttcatgataaaggactggtt
tggaacactgatcttgtagagacgctggagctacagaacctgatgcttaatggactccaa
actgtagcatctgctgaagcaaggaaagagaccaggggagctcacgctagagaagacttc
aaagatcgtgtggatgaatatgattacaagttaccactggaggggcaggacaaacttgat
gtcaaggatcactggcgcaagcacaccctttcttcaatgccttctgactctgaagtaaag
ctggactatcggccagtaattgatgagactttgaatgaaaatgattgtccaagtgttccc
ccaaccataagagtttattaa

DBGET integrated database retrieval system