KEGG   Amphimedon queenslandica (sponge): 100634020Help
Entry
100634020         CDS       T02284                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00010  Glycolysis / Gluconeogenesis
aqu00030  Pentose phosphate pathway
aqu00051  Fructose and mannose metabolism
aqu00052  Galactose metabolism
aqu01100  Metabolic pathways
aqu01200  Carbon metabolism
aqu01230  Biosynthesis of amino acids
aqu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100634020
   00030 Pentose phosphate pathway
    100634020
   00051 Fructose and mannose metabolism
    100634020
   00052 Galactose metabolism
    100634020
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100634020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aqu01009]
    100634020
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aqu03019]
    100634020
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100634020
Protein phosphatases and associated proteins [BR:aqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100634020
Messenger RNA biogenesis [BR:aqu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100634020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100634020
NCBI-ProteinID: XP_003386247
UniProt: A0A1X7V043
LinkDB All DBs
Position
Unknown
AA seq 846 aa AA seqDB search
MLRKIKMAASMEVASSPPLRTLSQPVETKDLMKKKDTEDRCLAVLTSGGDSQGMNAAVRA
VVRIALFKGMKPYLVNEGYKGLVEGGELIKECQWTDVTHTMHKGGTIIGTARCKEFRERS
GRLDAAANLVKARINNLVIIGGDGSLTGANIFKEEWKGLLEELVRKERITQEEAALLPYL
NIVGLVGSIDNDMCGTDMTIGTDSALHRIIEAMDCLVSTASSHQRTFVLEIMGRNCGYLT
IMAGIAVGAEWVLIPENPPKEGWEESMCDKLKSSREKGRRLNFILVAEGAIDQENKKITT
SDVKKVIDSKLGFDTRVTVLGHVQRGGRPSAYDRILGTRMGAAAVQTLFEAKGEMDAFMI
AIRGNEMTKLPLMSCVETTKKIGSALNERDFNRMQELRGSSFARNIKILKKLEACPTTTC
KPESSPSSPSYTFAVMNVGAPAGGTNSCTRSFVRFLLYSGHTVLGIYSGFDGLKEGEIKN
LDWSEVSEWGSVGGSKLGTTRTVPDDKSLDAIAKSLESHGIQGLLVVGGFEAFQSLIKLE
EGRRKYPALCIPIVQVAATISNNVPGTEYSLGCDTALNVIVSACDILKQSATASRKRVFV
VETMGGYCGYLATMGALAGGADSAYIFEESFNLDHLRKDVAHMVHKFKAGNFEKGIIMRN
ESCNNNYTTDFMTQMLAEEGKDYFIARSSVLGHLQQGDAPSPFDRILGTKYAYQSMNHLL
ECMERSTTSEGKVLATGSDTICVMGLVGVEYKPTPVSVLKDKCDMKYRIPNDQWWIQLRP
LVRILARHADKKFHGETDMIDDDTRSKEPHPPQFKGLSMNDVKPFLPPLLVLGAMIAMTF
ARLNNW
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaaaaataaagatggcagcttcaatggaagtcgcatcttctccgcctttgcgt
actctttctcagcccgtggagacgaaagatttgatgaagaagaaagatactgaagatcgc
tgcctggccgtccttaccagcggtggagattctcaaggaatgaatgcagcagtgagagct
gtcgtccgtattgctctgttcaaagggatgaagccttaccttgttaatgaaggctataaa
ggtctggttgaaggcggggaattgatcaaggagtgccagtggacggacgtcactcataca
atgcataaaggtgggacgataatagggacggcaagatgtaaagagtttcgcgagagatca
ggaagactggacgcagcagcaaaccttgtcaaagccagaatcaacaacctagtcatcatc
ggaggagacggtagcctcacaggagctaacatctttaaagaggaatggaaaggactcctg
gaggaactagttagaaaagagaggataacgcaagaggaagcagccttgcttccttacctc
aatatagttggactggtaggatccattgataatgatatgtgtggaactgatatgaccatc
ggtacagactcggcactccatcgtatcatagaagcaatggattgtcttgtgtccactgcc
tccagtcaccagaggacctttgtactggagataatgggacggaactgtgggtaccttacc
atcatggccggcatagccgtgggggctgaatgggtactgataccagaaaacccacccaag
gaaggctgggaggaaagcatgtgcgataaattaaagtcgtctcgagaaaaaggaaggcga
ctaaattttatcctagtcgctgagggggccattgatcaagaaaacaaaaaaatcacaacg
tctgatgtcaagaaagtaattgattcaaagctagggtttgatactagagtgactgtattg
ggtcacgtacaacgtgggggaagaccctctgcttacgaccgtatactgggcactaggatg
ggagcagctgctgtccagaccttgtttgaagcaaagggggagatggatgctttcatgatt
gctattagaggaaatgagatgaccaaactgcctctgatgtcttgtgtggaaacgacaaag
aagattggaagtgctctgaatgagcgagacttcaatcgaatgcaagagctaagaggatcc
agctttgctagaaacataaagatacttaagaagcttgaggcctgtccaacgaccacctgc
aaaccagagtcaagtcccagctctccttcttacacatttgccgtgatgaatgttggagca
cctgctggtggaaccaacagctgcaccaggtcctttgtacgcttcctattatacagtgga
cacactgtactgggaatatacagtggatttgatgggctaaaggagggagagattaagaac
ttggactggtctgaagttagtgagtgggggtcagttggtgggtctaaactgggtaccaca
cgcacggtccctgatgacaaatcacttgatgctatcgctaaatccttagagtctcatggt
atccaaggcctgctggtcgtcggtggatttgaagcgtttcaatctctgatcaagttggag
gagggtaggcgcaagtatccagcactatgcatccccatagtccaagtggcagctaccata
agcaacaatgtccctggcaccgagtatagtcttggttgtgatactgctctgaatgtcatt
gtctccgcttgtgacatactcaagcaatcggccactgctagcaggaagcgtgtctttgtc
gtggagactatggggggctattgtggctacctggcaacaatgggtgctctagcaggtgga
gctgacagtgcgtacatatttgaagagtcctttaatttagatcaccttcgcaaggatgtg
gctcacatggttcacaagtttaaagctggtaattttgagaaaggtatcatcatgcgtaac
gaatcctgcaataataactacacgactgatttcatgacgcagatgctagccgaagaaggc
aaggactactttatagccaggagcagtgtcttgggtcacctccagcaaggcgatgcaccg
agtccatttgatcgtatactaggcactaagtatgcctatcaatccatgaatcacctgttg
gaatgtatggagcgcagtaccactagtgaagggaaggtgttagccactgggagtgataca
atctgtgtcatgggtctagttggagtggagtataagcccacaccagtctctgttctaaag
gataagtgtgatatgaagtacaggatacctaatgatcaatggtggatacagctacgtcct
ctagtccgtatactagcgcgtcatgctgataaaaagtttcacggagaaactgatatgatt
gatgatgacactcgatcaaaggagcctcatcctcctcagttcaaaggattgtcaatgaat
gatgtgaagccattcttgcctccactactggtgttaggtgctatgattgctatgacattt
gctagacttaataactggtga

DBGET integrated database retrieval system