KEGG   Amphimedon queenslandica (sponge): 100634556Help
Entry
100634556         CDS       T02284                                 

Definition
(RefSeq) beta-galactosidase-like
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00052  Galactose metabolism
aqu00511  Other glycan degradation
aqu00531  Glycosaminoglycan degradation
aqu00600  Sphingolipid metabolism
aqu00604  Glycosphingolipid biosynthesis - ganglio series
aqu01100  Metabolic pathways
aqu04142  Lysosome
Module
aqu_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100634556
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100634556
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100634556
   00604 Glycosphingolipid biosynthesis - ganglio series
    100634556
   00511 Other glycan degradation
    100634556
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100634556
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aqu04147]
    100634556
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     100634556
Exosome [BR:aqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100634556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Phage_cap_E
Motif
Other DBs
NCBI-GeneID: 100634556
NCBI-ProteinID: XP_011402564
UniProt: A0A1X7VCU5
LinkDB All DBs
Position
Unknown
AA seq 653 aa AA seqDB search
MSCKMAAAVLFSRLHCKVFLLLFLCSGASLFIGVDSRSFTIDYDSNSFSKDGQPFRYISG
SMHYSRVPSYYWRDRLSKMYYAGLNAVQTYVPWNFHEPFPGVYNFEGDHDLVGFLKTAQD
VGLLVILRAGPYICGEWEMGGFPSWTLRNQPPPTLRSSDPSYLSLVDAWMGKLLPLVKPL
LYENGGPIITVQVENEYGSFYTCDQKYMNHLESTFRQYLGPNVVLFTTDGAGDGYLKCGT
IPSLYATVDFGATDNPEGYFAFQRKYEPKGPLVNSEFYTGWLDHWGQAHQTRNGDQIASS
LDKILALNASVNMYMFEGGTNFGFWNGANCGGQSYQPQPTSYDYDAPLNERGEMTDKFGL
LRSVIKKYHPVPSIPPIESDVSVYGDKSGHIYYDEYADLFESLKVLGTKQTTADRPLTFE
DMEQDFGFILYTPVDDITLSSSDQVTLTIDELHDRATIYWNRQLVGTLLRSAGLTKNMSV
SFNATSSKGSLAILVENMGRVNYGSYIADKKGILNGVYLNGVEVLHWTTTSLPLNNTNEL
QFTQVGSTTPPTSAVFYKASFTIDGSTLNDTYLLTDQWTKGVAIVNDFNLGRYWPVKGPQ
KTLYVPASVLKKGTNGVVLFEVDSAPNKGSTQFVDKPDLGLSVTRAFEAEVRW
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcaaaatggccgctgctgtgctgttttccaggctgcattgcaaagtgtttttg
ctacttttcctttgttcaggagcttcactcttcattggtgtagactctagatcattcacc
atcgactatgacagcaattcattctcaaaagatggacagccattcaggtacatatcaggt
agcatgcattacagccgtgttccctcttattattggagagacagactctcaaagatgtac
tatgctggcctcaatgctgtccagacctatgttccatggaactttcacgagccatttcca
ggagtttataactttgaaggagaccacgatctagttggatttctcaaaacagcacaagat
gttggtctattggtcatactacgtgctggcccttacatctgtggagagtgggagatgggg
ggattccccagttggactctcaggaaccaaccgcccccaactctacgtagctccgatcca
agttacctttcactcgttgatgcatggatgggtaaactccttccactcgttaaacctctc
ttgtatgaaaacggaggtcccatcatcactgtgcaggttgaaaatgaatacggcagtttc
tatacttgtgatcagaaatacatgaatcacttagagtcaactttccgtcagtatctagga
cctaacgtggtcctattcacaactgatggtgctggggatggatacctaaagtgtggtact
ataccatctctttatgcaactgttgattttggagctactgataatccggaaggatatttt
gccttccaacgcaagtatgagccaaaaggtccattggttaattcagagttttatacaggc
tggcttgatcactggggccaggctcatcagacgagaaatggagatcaaattgcttcttct
cttgataagattcttgccctcaatgcttccgtgaacatgtacatgtttgaagggggtacc
aattttggattttggaacggggccaattgtggtggacagtcataccaacctcaaccaaca
tcctatgattatgatgctcctctaaacgagagaggagaaatgacagacaagttcggcctg
ttacgctcggtcattaaaaaatatcatccagttccttcaattccgcctatagaatctgat
gtatctgtgtatggggataagtctggacacatttattatgatgagtatgctgatttattt
gagagtctcaaagtgctaggtactaaacagacaacggccgaccgaccgctaacctttgaa
gacatggaacaggactttggtttcatactctacactccagttgatgacataaccctctca
tcctctgatcaagtcacactaacaattgatgagctacacgatagggcaaccatatactgg
aataggcaactagtcgggactctccttcgttctgcaggacttacaaagaatatgagtgtg
tctttcaatgcaacctccagcaaaggatctcttgctattttggtagagaacatgggacgt
gtgaattatggctcttacattgctgacaagaagggaatcttaaatggcgtctatttgaat
ggagttgaagtacttcattggacgactacctcattgccacttaataatacaaatgagttg
caatttacccaggttggtagcactacccctcctacttcagcagtattttataaagcatca
ttcactattgatggctctactcttaatgatacatatcttctgactgaccaatggacaaaa
ggtgttgcaattgttaatgattttaaccttggtcgctactggccagtgaagggacctcaa
aagaccctgtatgtacctgcttctgtacttaagaaaggaacaaatggggttgtgctattt
gaggttgattcagctcctaataaaggctcaactcaatttgtggataagcctgatttaggc
ttgtcagtgacgcgagcctttgaagctgaggtcaggtggtga

DBGET integrated database retrieval system