KEGG   Amphimedon queenslandica (sponge): 100634817Help
Entry
100634817         CDS       T02284                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00052  Galactose metabolism
aqu00500  Starch and sucrose metabolism
aqu01100  Metabolic pathways
aqu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100634817
   00500 Starch and sucrose metabolism
    100634817
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100634817
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aqu04147]
    100634817
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100634817
Exosome [BR:aqu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100634817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 100634817
NCBI-ProteinID: XP_019853735
UniProt: A0A1X7UKX4
LinkDB All DBs
Position
Unknown
AA seq 985 aa AA seqDB search
MSAGKKGRYQVLEENHSIQTRKDTATCCLRPYQRCLLVASLCLLILIVIGLAVALVFTLS
PSSNKAGGNTPSPTPPPSNGCPIDPPNGSLPCPYTREGDCTTFGCCWYKNTTSCLLVPSC
NHDSNSLFSCLPEGDGWSYDKSEEVCHSRGCCWQPNATIRCSYSSNHGYRLDGKLQDGPF
GVMATLVRKESFPSMFGGDSKRLKVDVTYETDYRLRVKIYDESQSDRYQVPLNLTSKVFG
QTQTKKPSNMMYSFSLTESESFGFEIKRTSSQATLFKMAPGLVVSDQFLQISSHLPSSYI
YGLGEHATPWRLDMNYSKLTLFSRDVPPDPVFDTTRNLYGVHPMYLCMDNITGSAHGVFL
LNSNAMEIELLPYPAITYRTIGGVLDFYFLLGPSPDDVISQYTQLIGRPFLPPYWSLGFH
LCRWGYFSSERTLEVVERMRHYGIPQDTQWNDIDYMSDHLDFTYNHTSYATMPQLVDNLH
AHGQHYVVITDPGISATKPAGTYPPYDDGLDDRIFIMNETGSGPLLGMVWPGITAYPDFT
NPATESYWLEALTQFHDNISFDGLWIDMNEPSNFIPGSIYGCSNSTLNNPPYLPVAIRAQ
GSILDKTLCMTGVQYLSSHYNVHSLYGHTEAIETMRSLQSLFNKRSLVISRSTYPGSGVY
TGHWLGDNASQWPHLRQSIPGILNFALFGIPLVGADICGFFDNTTSQLCMRWQQVGAFYP
FSRNHNSYNTIAQDPTEFGEEVINSTRNVLLIRYKLLPFLYTLFYHAHTNGSMVATPLLS
VFPSDTETWSNARQFMWGKALLISPVLEENATSVVAYFPKGRWFDYRNGTEFVSKGQYVV
ILEAPLDYIPLHVLGGSIIPQQEPNTTTTLSKQNPYSLLVSLNATGESYGSLFIDDGEEL
DSIENGHYTLLAFHVEKGQLSSIVLSGGYSAAVNCTMNEVTVYGLSQEPAGVTGDDVIDW
NWTNNVLFINVNVTNLNKPFTLNWS
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaggaaagaaagggcgttatcaagtccttgaagagaatcacagcatacagacc
aggaaagatacagctacatgctgtctcagaccatatcaaagatgcttgcttgtagcatct
ttgtgtctgctaattctaattgtgataggactggcagtggctctcgtttttactctctcc
ccctcttctaataaagcaggtggtaatacaccctctcctactcctcctccctccaatggc
tgtcccattgacccgcccaatggctcactcccctgtccttacactcgagaaggggattgt
acaacttttggttgctgttggtataaaaacacaacatcttgtctacttgttccatcttgt
aaccatgacagcaactctctcttttcctgtctccccgaaggtgatgggtggagttacgac
aaatcagaggaggtatgtcactctcgtggttgctgttggcaaccaaatgcaaccatacga
tgttcctattcaagtaaccatggttacaggttagatgggaagcttcaggatggtcctttt
ggtgtcatggcaacactagtacggaaggaatccttcccatcaatgtttggaggtgattct
aagcgtctaaaagtagacgtaacttatgaaactgactacagacttagagtaaagatttat
gatgaaagtcagtcagatcggtatcaagttcctcttaatttgacgtcaaaggtttttggt
caaactcaaactaagaaaccttccaacatgatgtactcgttcagcctaacagagagtgaa
tcctttggttttgaaataaagagaacctcctcacaagccacactgtttaaaatggcccct
ggtcttgttgtaagtgatcagttcctacagatttcctctcaccttccctcttcatatata
tatgggctgggggagcacgccaccccctggagactagacatgaattattcaaaattgact
ttattttcacgtgatgtaccacctgatcctgtatttgatacaacaagaaacctctatggg
gtccatccaatgtatctctgtatggataacatcactggatcggctcatggcgtcttctta
ttgaacagcaatgcaatggaaattgagctgttaccatacccagccattacttatagaact
attggtggagtacttgatttctatttcttgctcggcccttcaccggatgatgtcatttca
cagtacactcaactgattggtcgcccattcctgcccccctattggtccctagggttccac
ttgtgtcgctgggggtacttctcttcagagcggacgctagaggtcgttgaaaggatgagg
cattatgggataccccaggatacccagtggaacgatatagactacatgagtgatcacctg
gacttcacttataatcatactagctatgcaacaatgccccagctggtggacaacctacac
gctcatggacagcactatgtagtcatcactgatcctggtatttcggcgacaaaaccagct
ggtacctatcctccatatgatgatggactggatgatagaatatttataatgaatgaaact
ggttccggaccactcctgggaatggtgtggccaggaattacagcatatccagatttcact
aacccggccacagagtcttactggttagaggcactcacacagtttcatgataacatcagt
ttcgacggactgtggattgacatgaacgaaccgtccaatttcatccctggatcaatctat
ggctgctctaactcaaccctcaacaacccaccctaccttccagttgcaataagggcacaa
ggaagtatactggacaagacactgtgcatgactggggtccaatatctctcctctcattat
aacgtccacagtctttatggacacaccgaggctattgagacaatgaggtctcttcagtct
ttgttcaataaaaggtcgctggtcatatctcgttccacttaccccggtagtggggtgtac
actggtcactggttaggggacaacgccagccagtggcctcacctcagacagtctatacca
ggtatcctcaactttgccctgtttggtattccgttggttggggcagatatttgtgggttt
tttgacaacacaacgagtcaactctgcatgagatggcagcaggtcggggccttctatccg
ttctctcggaaccataactcttacaatacgatagcacaagatcctacagagtttggtgaa
gaggtcattaattcgactcggaatgtccttttaatccggtacaagctcctcccattttta
tacactctattctatcacgcccacactaacggatcaatggtagccacacctcttttatca
gtctttccgtctgatactgagacttggtctaatgctcggcagtttatgtggggcaaggct
ctcctcatatctcctgtactggaggagaatgccacaagtgtggtagcttactttcctaaa
ggaagatggtttgactatagaaatggtacagagtttgtgagtaaaggtcagtatgttgta
atattagaggctccattggattatattccacttcatgtactgggaggatcaataatacct
caacaagaaccaaacactaccaccacactcagcaaacagaatccttacagcttgttggtg
tcattaaacgcaactggagagagttatgggtctctgtttattgatgatggagaggagctg
gattctatagagaatggacattatacacttttagcttttcatgtcgaaaaggggcagtta
agttctattgtcctcagtggtgggtacagtgcagctgttaattgtacaatgaatgaagtt
acagtttatggactgagccaagaaccagctggagttactggagatgatgtcattgactgg
aactggactaataacgtgttgttcattaatgtcaacgtaaccaatcttaataagccattc
actttgaactggagctaa

DBGET integrated database retrieval system