KEGG   Amphimedon queenslandica (sponge): 100635086Help
Entry
100635086         CDS       T02284                                 

Definition
(RefSeq) uncharacterized protein LOC100635086
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00290  Valine, leucine and isoleucine biosynthesis
aqu00770  Pantothenate and CoA biosynthesis
aqu01100  Metabolic pathways
aqu01210  2-Oxocarboxylic acid metabolism
aqu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    100635086
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    100635086
Enzymes [BR:aqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     100635086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ILVD_EDD FeoA
Motif
Other DBs
NCBI-GeneID: 100635086
NCBI-ProteinID: XP_003390882
LinkDB All DBs
Position
Unknown
AA seq 564 aa AA seqDB search
MQDSTDRSINRYSARITRPKSQGASQAQLFATGFSEADLEKAQIGIASIWYEGNNCNMHL
LDLAKKVKEGVEEVGIKGMRFNTVGVSDGMSMGTEGMSFSLQSRDLIADSIETVTRGQWY
DGLITIPGCDKNMPGCLMAMGRINRPSIMVYGGTIRAGRTAGGQVVDIVNAFQSYGQYLA
GSIDEAERAEIVRKACPGPGACGGMYTANTMATAIEAMGMSLPFSSSTPATDPAKIDECR
RAGAAVRALMERDIKPKDIMTRVAFENAMVMVMALGGSTNAVLHLIAMARAVDIPLGLDD
FQSVSDRIPYIADLKPSGRYVMEDLHRVGGVPAVMKYLLAEGLIDGSPLTCTGQTVADNL
AEVSPLAEGQDIVHPLDRPIKQSGHLRILRGNLAPGGAVAKITGKEGLRFEGQAKVFDAE
EDMLRALEEGGIVKGDVIVIRYEGPKGGPGMPEMLTPTSAVMGAGLGSDVALITDGRFSG
GSHGFIIGHIVPEAQEGGPIALVESGDRIVIDAQENSIAVDIDDDEMQRRRAAWTMPPFK
ETRGTLYKYIKTVSDASYGCVTDE
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcaagactcgaccgatcgctcgatcaaccgctacagcgctcgcatcacccgacccaaa
tcccaaggggcttcccaagcccagctcttcgccaccggtttttccgaggcggatttggaa
aaagcccagatcggcatcgccagcatctggtacgaggggaacaactgcaatatgcatttg
ctcgatctggccaagaaggtgaaagagggggtggaggaggtcgggatcaagggcatgcgc
ttcaataccgtcggcgtctccgacggcatgtcgatgggcaccgaggggatgtccttttcc
ctgcaatcgcgcgatctgatcgccgattccatcgagaccgtcacgcggggccagtggtac
gacggcttgatcaccatccccggctgcgacaagaatatgcccggctgcctgatggcgatg
ggtcgtatcaatcgcccctcgatcatggtctacggcggcaccatccgcgccggccgcacc
gccggcggacaggtcgtcgatatcgtcaacgccttccaaagttatggccagtatttggcc
gggagcatcgacgaggcggagcgggcggagatcgtgcgcaaggcctgtccgggtcccggg
gcctgcggcgggatgtataccgccaacaccatggccacggccatcgaggccatgggcatg
tccttgccctttagttcctcgaccccggccacggatccggccaagatcgacgagtgtcgg
cgagcgggcgcggcggtgcgggcgttgatggagcgcgatatcaaacccaaagatatcatg
acccgcgtggccttcgaaaatgcgatggtgatggtgatggctttgggcggctccaccaac
gcggtcttgcatttgatcgcgatggcccgcgccgtggatattcctttaggcctcgacgac
ttccagtcggtcagcgaccgcatcccctatatcgccgatctgaagcccagcgggcgctat
gtgatggaggatctgcatcgggtcggaggggtgcctgcggtcatgaaatacctcttggcc
gagggcctgatcgacgggagccccctgacctgcactggccaaacggttgccgataacctc
gccgaggtatcgcctttggccgagggtcaggatatcgtccatccgctggatcgaccgatc
aaacaaagcggtcatctgcgcatcctgcgtggaaacctcgcccccggcggcgccgtggcc
aagatcaccggcaaggaagggcttcgcttcgaggggcaggccaaggtcttcgacgccgag
gaggatatgctgcgagccttggaggagggggggatcgtcaaaggagatgtgatcgtgatc
cgctacgaggggcccaaaggcggaccggggatgccggagatgctgaccccgacctcggcg
gtgatgggggccgggctcggctccgatgtggcattgatcaccgacggtcgcttttccggg
ggctcccacggattcatcatcggccatatcgtgcccgaggcccaagagggcggcccgatc
gcattggtcgaaagcggggatcggatcgtcatcgatgctcaggagaattcgatcgccgtc
gatatcgacgacgatgaaatgcaacgccgccgcgcggcgtggacgatgccgcccttcaaa
gaaacccgcggcaccctctacaaatatatcaagaccgtctccgatgcatcttatggatgc
gtcaccgacgaatag

DBGET integrated database retrieval system