KEGG   Amphimedon queenslandica (sponge): 100636074Help
Entry
100636074         CDS       T02284                                 

Definition
(RefSeq) tyrosine-protein kinase ABL1-like
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aqu01001]
    100636074
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100636074
Protein kinases [BR:aqu01001]
 Non-receptor tyrosine kinases
  ABL family
   100636074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_9 SH3_2 SH3_1 Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 100636074
NCBI-ProteinID: XP_011403964
UniProt: A0A1X7UVT4
LinkDB All DBs
Position
Unknown
AA seq 813 aa AA seqDB search
MGNKSSSASSSGSGISERRHTKKKVPSTSPATSTRSPRPPIPLPPNSYNDLEYRTEPMEP
DPPQENGAGDDFDRNNLSPESVSAHSLTPDRKWQSLENLTEGDPDSDDPNLYVVKHDYVT
NQSGQLSIRKGDKIRVTPGRGTGDWVEGTNANGQTGWLPASYIAKIDSLEKHSWFFGNIT
RAEAELNLGSGINGSFLIRESESKPGQYSISLRFEGRVFHYRIHIDPSSEQYYVTPESKF
DTLTELVKHHSKNADGLTTTLHYPAPNSHKPPVYGVSHDFDKWEFDRSNLEMGLKLGGGQ
YGEVYKAVMKGRGVNVAVKTFREETTDATEFLKEANVMKKVKHPNLVQLLGVCTRELPFF
IITEYMPKGNLLDYLRSTEGKTLDAVVLVYMAQQVASAMAYLENMNMIHRDLAARNCLVG
ENYLVKVADFGLSRLMESDIYNAREGAKFPIKWTAPEALAYNKFSIKSDVWAFGVLLWEL
ATYGMSPYPGAELAQVYELLESGYRMQNPEGCPSAVYNLMTQCWEWLPEDRPSFAELSRI
LNGLSDVNETVEATLRGENPTRFDSISVETPTAQHTSFSQKRTQSNGGHPPRPPLPSVPK
QDQPELPPPRASRGLPPPPISRGNQEETPRPPPLRGTRKPSMDTPSTTGGPAIPARPKPP
PPGRPAVPITSPNRGTSSKPATAPKPPIKGPKPVVPKKTTELSLGLSKPDELSLSDKIDR
LQSNAPLLIDFVNQQRPNLARDLSDFAQLVTYIIEEAQRAENDSSVTFKRCIAVLQSQRG
ALTDSTVQSDPTKLTKAIEVLVTKSQVLSSHLK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacaagtccagtagtgcttcctccagtggaagtggcatctctgagcgaagacac
acaaagaaaaaggtcccgtccacgtctcctgcaacctcgaccaggtccccacgtcctcct
atccccctcccccctaactcgtacaatgacttggagtacaggacagaacccatggagcct
gacccgccccaagaaaatggtgctggcgacgatttcgatcgtaacaacttaagccctgag
tcagtctccgcccattcccttacacccgacagaaaatggcagtcgcttgaaaatctcacg
gaaggcgaccccgattctgacgaccctaatctttacgtggtgaagcatgactatgtgacc
aatcaaagtggtcagctctcgatacgaaaaggtgacaagatcagggtcaccccgggcagg
ggtactggcgactgggtcgaaggtactaatgcaaacggtcagacgggttggctaccagct
tcgtacatcgccaagatagacagtcttgagaagcactcgtggttctttggtaatatcact
cgggcggaggcagagctgaatttgggttctggcataaacgggtcctttcttattcgagag
agcgagagcaagccgggacaatactcaatctcgcttagatttgagggaagggtttttcac
tatcgtatacacatagacccctcatcagagcagtattatgtaacgccggaatcaaaattt
gatacgttaactgaacttgttaagcatcactctaagaatgcggacggattgacgacgact
ctgcattaccccgcccccaattcacacaagcctcctgtttatggggtgtcacatgacttt
gataagtgggagttcgacaggtcgaatctagaaatgggtctgaaactaggtgggggtcag
tacggggaggtttataaagctgttatgaaaggtcgtggggtgaacgtggctgtcaagaca
tttagggaagaaacaacagatgctacagaatttctaaaagaggcaaacgtgatgaagaaa
gtaaagcacccgaaccttgtccagctccttggagtgtgcacacgggaactgcctttcttt
atcatcacggagtacatgcccaagggtaacctcctggattatctgagaagcacagaaggg
aagacacttgatgctgtagtcctggtgtatatggcacagcaagtggcatcagctatggct
taccttgaaaacatgaatatgattcatagggatttagccgctaggaattgtttggttggt
gagaactatctagtcaaagtggccgactttggtctgagcagactcatggagagcgatatc
tacaacgccagagagggggctaagtttcccataaaatggacagcaccagaagcccttgct
tacaataaattttcaataaaatctgacgtttgggcatttggagtattgctatgggaactg
gcaacatatggaatgtctccgtatcctggagctgaattggctcaagtctacgaactactg
gagtctgggtacaggatgcaaaaccccgagggttgtccctctgcagtttataacctcatg
acgcagtgctgggagtggttaccagaggatagaccatcttttgcggaattatctagaata
cttaatggcctttcagacgtcaatgaaactgtagaggcgacactaagaggtgagaacccg
actcggttcgacagtatttcagtcgagacacctacagcccagcacacgtccttctcacag
aaacgcactcaatcaaacggcggacacccaccccgacctcccctcccctcggtaccgaaa
caggatcagccagaactccctccccctcgtgcaagccgaggcttacctcctccgcccatt
agcagaggcaatcaagaggaaacaccacgcccacctcctttaagaggtaccagaaaacca
agcatggacacgccctcaacgaccggtggtccagccatccctgctcgtccaaagcctcct
cctccgggtagaccggccgttcctattacttctccaaatagaggaacttcttcaaagccg
gcgactgctccaaaacctcccattaaaggaccgaaacctgtcgtgcctaaaaagactacc
gaattatcgctgggtctctcgaaaccagacgagctgagtttgtcggacaagatagacaga
ctccaaagcaatgctcctctgttaatagactttgtcaatcagcagagacctaatctcgct
cgagatctctcggatttcgctcagttagtgacttacatcatagaagaggctcaaagagca
gagaacgattcttcggttacttttaaacgttgcattgctgtactacagtcccagagagga
gctcttaccgattcaacggttcagtccgatccgactaagttaacgaaagcgatagaagtg
ttagtgactaagagtcaagtactctcaagtcatctcaagtga

DBGET integrated database retrieval system