KEGG   Amphimedon queenslandica (sponge): 100640366Help
Entry
100640366         CDS       T02284                                 

Definition
(RefSeq) serine/threonine-protein kinase Sgk1-like
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100640366
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aqu01001]
    100640366
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100640366
Protein kinases [BR:aqu01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   100640366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PX Kinase-like Pkinase_C Haspin_kinase Kdo YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 100640366
NCBI-ProteinID: XP_011403713
UniProt: A0A1X7UYE6
LinkDB All DBs
Position
Unknown
AA seq 505 aa AA seqDB search
MATLDPSAANGGGDPARPRGQTTAAVEDHETWVEEKRFTMYKVVVRLEDRSYFIFRRYNE
FNTLLDKIKKRYPDSNLKLPGKRIFLNNFDPAFIKQRRQGLNDFIVNLIKIPSIFDDEAV
RDFLSLDDQRSTIPIYDRESLDEEAGSEDKTANRFDLGTSEKESAAITDFKLLKVIGKGS
FGKVYLGRHIDTNKHYAIKVLQKKAIVKRNEVKHIMAERNVLLRNVTHPFLVGLHYSFQT
GTKLYFVLDYVNGGELFFHLQRERVFEEPRARFYAAEITSALGYLHEQDIVYRDLKPENI
LLDKQGHIILTDFGLCKEDVKQGETTSTFCGTPEYLAPEVLRKQDYGRPVDWWCLGVVTY
EMMYGLPPFYSRDVAEMYDGILHKPLRLRPNITPAGRSLLEGLLQKDKNHRLGSGVRDYK
DIMDHLFFRSINWDDLFLKKLEPPFNPNVSGDLDLRHFDQEFTNEAISDNPSPPKSTSAG
MSISVQDETFAGFSYIPNEGKYMPS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggctaccctagatccttctgctgccaatggaggaggggaccctgctagaccaagagga
caaacaactgctgctgttgaggaccatgagacttgggtcgaggagaaacggttcaccatg
tacaaggttgtagtaagattagaggatcggtcatatttcattttcagacgttacaacgag
ttcaacacattactggataagataaagaagagatatcccgactccaacctcaagctaccc
gggaaaaggatctttctcaataactttgacccggccttcatcaaacagcggagacaaggt
ctcaacgattttatcgtcaacctcattaagatccccagtatatttgacgatgaagcagtt
agggacttcctatcccttgacgatcaaagaagtaccataccaatttacgacagagagagc
cttgacgaggaggccggttccgaagacaagactgctaatcgatttgacctcggtacgtca
gagaaagaatcggcagccatcactgatttcaagttgctgaaggtcattggtaaaggaagc
tttgggaaggtgtatctagggcgccatattgatactaataaacactacgccattaaagta
cttcaaaagaaagcgatagtgaagaggaacgaggtgaaacacattatggcagaaaggaac
gtcctcttgaggaacgtgactcatccattccttgttggccttcattattcattccagacc
gggactaaactgtattttgtgttggattatgtgaatggaggggaactcttcttccacttg
cagagagaaagagtttttgaagagccaagagcaagattctatgctgctgagattacgtct
gcgttaggctatcttcacgaacaggatatcgtctatcgcgatttgaagcctgaaaatata
ctccttgataaacaaggtcacattattttaactgattttggattgtgtaaagaggacgtc
aaacaaggtgaaacaacttcaacgttttgcggcacacccgagtaccttgcccccgaggtc
ctccggaagcaggactacggtcgaccggtcgactggtggtgtttgggtgtggtcacttac
gaaatgatgtacgggctcccaccattttacagtcgtgatgttgctgaaatgtatgatggt
atactacataagcctcttcgtcttcgtcctaacatcactccagctggtcgctcactcctg
gagggactcttacagaaagacaagaaccacagactcggctctggtgttagggactataag
gatatcatggatcatttgttcttccgtagtataaactgggacgatctttttcttaagaaa
ttagaaccaccattcaatcctaacgtatcaggtgatcttgatttgcgtcactttgatcaa
gagttcactaacgaggctatatcagataatccttctcctcccaagtcgacaagcgctgga
atgagcattagcgttcaagatgagacttttgctggattctcttatatccctaacgaagga
aagtacatgcctagttaa

DBGET integrated database retrieval system