KEGG   Amphimedon queenslandica (sponge): 100640802Help
Entry
100640802         CDS       T02284                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle-like
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00500  Starch and sucrose metabolism
aqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100640802
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aqu01003]
    100640802
Enzymes [BR:aqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100640802
Glycosyltransferases [BR:aqu01003]
 Polysaccharide
  Storage polysaccharide
   100640802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 100640802
NCBI-ProteinID: XP_019854090
LinkDB All DBs
Position
Unknown
AA seq 682 aa AA seqDB search
MELSKLSLEDHSLSEDKVVAEPFRFSFEIAWEVAHKVGGIHTVIRSKAPVTTAELGDQYC
MIGPYHEPTVKLEVEVMEPELSVTKEVVESMKKEGVKVVYGRWLIEGYPKVILFDLGSSY
WRLSQWKQEIWDLCHIGIPDNDGESQDAVVFGFLTFWFISEFVRRIPGPSPLVVAQFHEW
MSGIGLLMLRLKKIPVATIFTTHATLLGRYLCAGKADFYNNLPFFNVDKEAGDRQIYHRY
CLERAAATICHTFSTVSKITAEEAEHLLKRKPDVVLPNGLNVIKFSAMHEFQNLHAQSKE
KIHDFVRGHFHGHYDFDLDKTLYFFIAGRYEFSNKGADLFLESLARLNHYLKVCNSDITV
VAFFIFPAPTNSFNVASLKGQAITKQLRETVDSIQAQIGKKIYESTLRGHLPDPQTFLEK
EDIIKLKRSMFSAQRTDLPPVVTHNVLNSDSDPVLSHIRRIQLFNRREDRVKVIFHPEFL
SSTNPLFKMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFISENV
TDPPAYGLYIIDRRFKNVEESVQQLSQYLFEFCSQSRRQRIIQRNRTERLSELLDWEQLG
KYYRMARKMALKAVHPDYFKRSGAATPVHTDKFPRPLSLPPSEPPNLSEDEEDEEDEDED
EGDDYEAASSPHHSLSSSVAST
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggagctctccaaattgagtctggaagaccattccctctcagaagacaaagtagtagcc
gagccttttcgtttcagctttgaaatagcctgggaagttgctcacaaagttggtggtatt
cacactgtgattaggagtaaagccccagtcactactgccgagttaggagaccagtattgc
atgataggaccctaccatgagccaaccgttaagctagaagtagaggtgatggagcctgag
ctctctgtcactaaagaagtcgttgagtccatgaagaaggaaggagtcaaggttgtctat
ggtcgctggctcattgaaggttacccgaaggtgatattatttgatttgggttcctcgtac
tggcgtctgagtcagtggaagcaggagatatgggatctctgtcacattggtatccctgat
aatgatggagagtcacaagacgctgtcgtctttggcttcttaacattttggttcatatct
gaatttgttaggcgtatccctggtccctctccgctggttgttgctcagtttcacgagtgg
atgtcaggtattggcctcctgatgctcaggttaaagaagatcccagtggcaaccatattc
acaacacacgctactctgttgggtagatacctttgtgcagggaaagcagacttttataat
aatctacctttttttaatgttgacaaggaagctggtgataggcagatatatcacagatat
tgtttggagagggcagctgctactatatgtcacacgttttctacagtctcaaagatcact
gcagaagaagctgaacatttgctaaagaggaagccggatgttgttcttcctaatggttta
aatgtcattaagttcagtgcaatgcatgagtttcagaatcttcatgctcagtctaaagag
aagattcatgattttgtgagaggtcatttccatggccattatgattttgatcttgacaag
actttgtatttttttatagctggcaggtatgaattcagtaacaaaggagctgatctcttt
ctagaatcactagctagactcaatcattatttaaaagtgtgcaatagtgatatcactgtt
gttgccttcttcatatttcctgctccaacaaacagctttaacgttgcttctttgaaagga
caagctatcacaaaacaactgagagaaactgttgattcaatccaagctcaaataggcaag
aagatttatgagagcacattgagaggacatcttcctgaccctcaaacttttcttgagaaa
gaagatatcataaaattgaagagaagcatgttctctgcccagaggacagacttaccacca
gttgtgactcacaatgtcctcaacagtgactctgaccctgttctctctcacatcagacga
atacaattattcaatagaagagaggacagggtgaaggtaatatttcatcccgagttcctt
tcatcaactaatcctttattcaagatggattatgaggagtttgtcagaggctgtcatttg
ggagtgttcccgtcatattatgagccgtggggatacaccccagctgagtgcactgtaatg
ggcattccttctgttactactaatctctctggctttggttgctttatatcagagaatgta
actgatcctccagcctacggactgtacattattgatagaaggtttaagaatgtggaggag
tcagtccaacaattgtctcagtatttgtttgaattctgttcccagtcaaggagacagcgt
atcatacagaggaacaggactgagagactgagtgagctcctcgattgggagcagcttgga
aagtattatcgcatggccaggaagatggcactaaaggctgtccatccagactactttaag
agatctggagctgcaactcccgtccatactgacaagtttcccagacctcttagtcttcca
cctagtgagcctccgaacctcagtgaagatgaggaagatgaggaagatgaagatgaagat
gaaggagatgattatgaagctgccagctctccacatcattctctctcttcctcggttgct
tcaacgtga

DBGET integrated database retrieval system