KEGG   Amphimedon queenslandica (sponge): 100641664Help
Entry
100641664         CDS       T02284                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00040  Pentose and glucuronate interconversions
aqu00051  Fructose and mannose metabolism
aqu01100  Metabolic pathways
Module
aqu_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100641664
   00051 Fructose and mannose metabolism
    100641664
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     100641664
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox_2 Pilt
Motif
Other DBs
NCBI-GeneID: 100641664
NCBI-ProteinID: XP_003383541
UniProt: A0A1X7VNH9
LinkDB All DBs
Position
Unknown
AA seq 352 aa AA seqDB search
MAANKKVSSAVLYGKKDLRLEDGEFSAEPGKGEVLIGVQSVGICGSDIHFWVDGHIGDCT
VVAPTILGHEASGVVIAIGEGVTNLQPGDRVAIEPGIPCHHCQYCKSGHYNHCPYVKFGS
TSPNNGYLTNYTIHPAEYCFKLPDHVSFDEGALLEPVSVAVHACRRVSVGLGSKVLITGA
GPIGLVCLMVAKACGASVLIATDLDSKRLEVAKSCGATHTCLIDKTSTSRQVAEEVKRTI
GASPDITIECSGAASAISAGIYATKSGGSVLMVGLGAPLATLPIVDASVREVDLIGVFRY
VNCFPAALDLIASGKINTKALLSHKYALGEVLSAFEMAKSGKAVKVIVDCSF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaataagaaagtttcgtcggctgttctttacgggaaaaaggatttaagactg
gaggacggagagttttctgccgagcccggtaaaggagaggtattaataggagtccagtca
gttggtatatgtggtagtgatattcatttctgggttgatggtcatattggtgattgtact
gtagtagctcctacaatattgggacatgaggccagtggtgtcgttattgcaataggagaa
ggtgtcaccaaccttcaacctggggatcgtgttgctatagagccaggtataccttgtcac
cattgccagtactgtaaaagtggacactataatcattgtccttatgtcaaatttggatcg
acttcacctaacaatggctacctcactaattacaccattcatccagcagagtattgcttc
aagctaccagaccatgtctcatttgatgaaggtgcactgttagagcctgttagtgttgca
gttcatgcttgtcgtagggtcagtgttggattaggtagtaaagtactcataacaggagca
ggtccaattggattggtatgtttgatggttgctaaagcttgtggggcctctgtactaata
gctacagatctggacagtaagaggctagaagttgctaaatcttgtggagctacccacact
tgtctcattgataagaccagtactagtagacaagtagctgaagaagtgaagaggacaatt
ggtgcatctcctgatatcactattgaatgctctggagctgcttctgcaatatctgctggg
atatatgctactaaatcaggagggtctgtgctaatggttggattaggtgctcctcttgct
actctcccaatagttgatgccagtgttcgtgaagttgaccttattggtgtatttagatat
gtgaactgtttcccagcagctctggatctgatagcatcaggtaaaatcaacactaaggct
cttctttctcacaaatatgctctgggtgaggtactctctgcattcgagatggctaagagt
ggaaaagcagtcaaagttattgtagactgttctttttaa

DBGET integrated database retrieval system