KEGG   Amphimedon queenslandica (sponge): 100641788Help
Entry
100641788         CDS       T02284                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu03030  DNA replication
aqu03410  Base excision repair
aqu03420  Nucleotide excision repair
aqu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100641788
   03410 Base excision repair
    100641788
   03420 Nucleotide excision repair
    100641788
   03430 Mismatch repair
    100641788
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aqu03032]
    100641788
   03400 DNA repair and recombination proteins [BR:aqu03400]
    100641788
Enzymes [BR:aqu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100641788
    6.5.1.6  DNA ligase (ATP or NAD+)
     100641788
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100641788
DNA replication proteins [BR:aqu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100641788
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100641788
DNA repair and recombination proteins [BR:aqu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100641788
   NER (nucleotide excision repair)
    Other NER factors
     100641788
   MMR (mismatch excision repair)
    Other MMR factors
     100641788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase FERM_N_2
Motif
Other DBs
NCBI-GeneID: 100641788
NCBI-ProteinID: XP_003382914
UniProt: A0A1X7VUF4
LinkDB All DBs
Position
Unknown
AA seq 862 aa AA seqDB search
MSLLNFFSKVTQEKGKRKRETKNDDLGEEHNIIKNDEREKKRVEEEEEEEDVIRRCKRPR
QAVIESDSDGELETKDGSRQEEMETNSVPSLPVKTNSTSSVTKTPPKRATARKHTGRVTA
AAKTIIKKKDTQEDPVIKPKSQADDVKDVVVSEETKEAKEESCPVSECEKIEKSSSLAED
KENNSVSAGEKKESFAKKTSTSSSFDPTKINYHPVKDACWTKNQKVPYLAIAKTFQQIEQ
ISGRLKIISILTNFLRSVIALSPRETTQCIYLCLNKLGPAYKGLELGIGDNILIKALSSA
TGRNPQQIKAEVAEKGDLGLIAEASRSTQRTMFAPPPLTISSVFNKFTEIAKLTGHSSQN
KKVDIIKSLIVSCKDCEAKYLTRSLSGKLRIGLAEQSVLVALAHAVKYTPPGQDIADASQ
GVNGEKFRKELDAAAAIVKNAYCELPNYDILIPALLEHGLDELPNHCSLTPGIPLKPMLA
HPTKGIQEVLRRFEQSEFTCEWKYDGERAQIHLLDDNTVQIYSRNQEDNTSKYPDIIARI
PQVLKTAGEGEEGEREGVKSCVIDAEAVAWDIEKKQILPFQTLSTRKRKDANISEIKVQV
CVFAFDLLFLNGRPLVREPFRVRRELLKSSFKEIEGEFMFVQSIDSTNIEDIQSFMDESM
KGNCEGLMVKCLDKDASYEIAKRSRNWLKLKKDYLEGVGDTLDLVVVGGFHGTGKRTGKY
GGFLLACYDEENEEYQVICKIGTGFKDEELEQHTSYLKDHVIDGPKSYYSTSDSITPDHW
FEPVQVWEVKAADLSVSPVYPAAAGIIDPEKGISLRFPRFLRIREDKKPEQATTNQQVAI
LYRQQQNIVKQTETNEDIDDLY
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgctgaatttctttagcaaagtcactcaagaaaaaggcaaaaggaaacgtgag
accaaaaatgatgatttaggggaggaacataatattattaagaatgatgagagggagaaa
aagagggtggaagaggaggaggaggaggaggatgttatccgacgttgtaagagaccccgt
caagcagtgatagagagtgacagtgatggagagttggagacaaaagatggaagcagacaa
gaagagatggaaacgaatagtgtaccatcattgcctgtgaaaactaatagtactagtagt
gtcaccaaaacacctccaaagagagccacagctcgaaaacacactggaagagtaacggca
gctgcaaaaacaataatcaagaagaaagacactcaggaggatcctgttatcaaaccaaag
tctcaggctgatgatgtgaaagatgtagttgtgtctgaagagactaaagaagctaaagaa
gaaagttgtcctgtttctgaatgcgaaaaaattgaaaaatcaagttcacttgcagaagat
aaagagaataacagtgtgtctgctggtgaaaaaaaagaaagctttgcaaaaaagacttca
accagctcttcttttgatcccacaaagataaactatcatcctgtaaaagatgcttgctgg
acaaaaaatcaaaaagttccctatcttgctattgctaaaacatttcaacagattgagcaa
atatcaggaagattgaagataatcagtattttaactaattttttacgatcagtaatagct
ctttctcctcgggaaacaacgcaatgcatttacttgtgcctcaacaagctggggccagct
tataaaggccttgaacttggtattggtgacaatattctgattaaagctttgtcaagtgct
accggtcgaaatccgcagcagatcaaagctgaagtggcagagaaaggtgacctaggttta
atagcagaagcaagcagatcaacacaacggactatgtttgctccgcctcctcttaccatt
agtagcgtatttaataaatttacagagatagctaaactgaccgggcattcttctcagaat
aagaaagttgacataattaaaagtctgatagtcagttgtaaagattgcgaggctaaatat
ttaacaagatcactaagtggtaagctacggatcggtttagcggaacaatcagttctagtt
gctcttgctcatgctgtcaaatacacaccacctggacaagatattgctgatgccagtcag
ggggtcaatggagagaagtttcgtaaagagctggatgcagcagctgctattgtcaagaat
gcttactgtgaattgccaaactatgatatcttgatacctgctctacttgagcatgggctg
gatgagctgcccaatcactgctccctgactccggggataccactaaaaccaatgctagct
caccccactaaaggcatacaagaggtactcagacgatttgagcagtccgagtttacatgt
gaatggaagtatgatggtgaaagggcccagattcatttattggatgacaacactgttcag
atatacagtcgcaaccaagaggacaatacttctaagtatccggacatcatagcaaggatt
ccacaggtgttgaagactgctggagagggagaggaaggagagagagagggagtgaagtct
tgtgtgattgacgctgaagctgttgcgtgggatatcgagaagaaacaaatacttcctttc
caaactctgagcactagaaaaagaaaagatgcaaatatttctgagattaaagtccaagtc
tgcgtctttgcctttgacctgttatttcttaatgggagacctttagttagggaacctttt
agagttaggcgagagctattgaagtcttcattcaaagagattgaaggggagtttatgttt
gttcaaagtattgattctactaatattgaagacattcagagctttatggatgaatcaatg
aaaggtaattgtgaaggcttaatggtcaagtgtcttgataaagatgcatcatatgaaata
gcaaagagatcccgcaactggctaaaacttaagaaggattatcttgagggtgtgggcgac
acactagatctcgttgtggttggtgggtttcatggaacgggaaagagaacaggaaagtat
ggcgggtttctactggcttgctatgacgaggaaaacgaagaatatcaagtcatttgtaaa
attggtactggtttcaaagatgaggagttagaacagcacacttcatatcttaaagatcac
gtcatcgatggacctaaatcatactacagcactagtgatagcattacccctgaccactgg
tttgagcctgtccaagtctgggaagtaaaggcggctgatctctctgtgtctcctgtttat
ccagctgctgctggaattattgatccagagaaaggcatttcacttcgtttccctcgtttt
cttcgtataagagaagacaagaaaccagagcaagccactaccaatcaacaggtagcaatt
ctttatcgtcagcagcagaacattgtcaagcaaacagagactaacgaagatatagatgat
ctctactaa

DBGET integrated database retrieval system