KEGG   Amphimedon queenslandica (sponge): 109583973Help
Entry
109583973         CDS       T02284                                 

Definition
(RefSeq) uncharacterized protein PB18E9.04c-like
  KO
K22700  Zinc finger CCHC domain-containing protein 2
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
KEGG Orthology (KO) [BR:aqu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    109583973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX SAM_1 zf-CCHC SAM_2 Oscp1
Motif
Other DBs
NCBI-GeneID: 109583973
NCBI-ProteinID: XP_019855079
UniProt: A0A1X7UBK1
LinkDB All DBs
Position
Unknown
AA seq 993 aa AA seqDB search
MKVSEVIQSIQGMPVCDRLYLLCQLLQRCVTYELAYLRSILLGNLSENLSSLSTPESLAN
KMDFLTFNCLSLDDEVLDKVICSLSLLHYDNRPVAQKIFSLLSEREILAKAEENESQETL
DKLRLLYVLAVYHPAMSFNQQHHLLTIFLRHLDELYELREKEIERKKEEAETIALAASER
PSIPSDEATIRRCELKGVYKRQSDKRYPYILEVEWSNGACSHIQRTYGDFFTFQNKLLDI
FPEESGQRSKKQRVIPFLPGRKLLSGRTNRELAEKRLPDLWKYTHDLFTLPEHISQCKHV
IDFFRPRQTDARDEILANHKITTLADMKNAKPRGSVSFLNSSSPSSSPSRPHSAIQHVLN
PSSASPSARSSNTLPAQQSPGQKDSNQINRRSTYPARPSGTSAFTVVTPTGSSEKLHSLS
QTSITSTNEVLNPPTTVACHVVTPPTSRSNGSPAFSVSNNKFNSPVGGGGGVWDSESPTV
IKFVRSGKSKGDKGEKSKESKRKNSKESNSSSSLNKADTLTHKSAPSWADRCDSPPNIES
SLSPFQTVTTTYNTPPTSSTHRTTTPSVVPSSAPPETGSLSFSPSLPQLYQYGLHTPLYP
ISYTPTHFDTPSPKPTPLGSRTPGTPTTEAEHFKKWLKCHRLHKYDNLFTNMSFEEVTKL
TVENLKSIGMTQGAAKKLSQKLNEQLINGATSFRDMPIPAISRRPSTTSLPAALLLERQQ
LTPSSSIDQLSLHGGSTCSLDVLGHSYSHHSTPKHLHRHSDSISDANTVDTAILEAGPSS
NVYTRGGNEIDGSRGNTVNGQSRLSYTSSSPLHWAPTPYVVTTPTDKDTELKDEFNRPTY
SHKKESDHQPRLPHRLVPQGTTNRMQGIVASNWPHPLPAPPPTVPPQMVRGVHRNSQPVL
TYTQTVNGLVRSSPVLHAGSGPPSNRYSAPPIQQSLATPQIYYSSSSRSPGPSPSSSYSC
YNCGNRGHQGVTCPLLYTSPPSSSSNNSALLRS
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtctgaggttatccaatcaattcaagggatgcccgtttgtgacaggctctat
cttctctgtcagttgcttcaaagatgtgttacgtatgaattggcctacctgagatccatt
ctacttggtaacttgtctgaaaacctctcctctctctccacccccgaaagcttagcaaat
aaaatggatttcctcacattcaattgtttatcactagatgatgaagtccttgataaggtt
atctgttccctctctttacttcattacgacaaccggcctgtggctcaaaagatattttct
cttttaagtgagagagaaatactggcaaaggctgaagaaaatgagagccaagagacgctt
gataagctccgcctactctatgtcctggctgtttatcatcctgctatgtcattcaatcaa
cagcatcatttattgaccattttcttgagacatcttgatgaactttatgagctaagagaa
aaagaaatagagagaaagaaagaagaagctgaaaccattgccttggcagcatcagagcgt
cccagcataccttctgatgaagcaacaataagacgctgtgaattgaaaggtgtatacaag
agacaatcagataaaagatatccatatatattagaggtggagtggtctaatggggcttgt
tctcacattcagcgtacatatggtgacttctttacatttcaaaataagctgttggacata
tttcctgaggaatctggacagaggagtaagaagcaaagagtgataccattcctgcctggt
agaaaattgctctctggtcgtactaatagagaattagcagagaagcggttacctgatctc
tggaaatatactcatgatttatttacactgccagaacacatttcacaatgcaagcatgtg
atagacttcttccggccacgccagactgatgctagagatgaaatactagccaatcacaag
ataactacactagcagatatgaaaaatgctaagccaagaggttctgtatcttttctcaat
agctcatctccatcctcctccccctctcgtccgcactcagccatacaacatgttcttaat
ccatcttctgcctctccatctgcacgaagctccaataccctccctgcacagcaatcgcct
ggtcaaaaagactccaatcaaattaataggagatcaacttatccagcacgtcccagtggg
accagtgcttttactgttgtaactccaactggttcaagtgaaaaactacactcattatcc
cagacctctatcactagtacaaatgaggttttgaatcctcccactactgttgcctgtcac
gttgtgacacctcctactagtaggagtaacggctctcctgctttttctgtgagtaataat
aaatttaattctccagttggaggaggaggaggagtatgggattctgagtcacctactgtt
atcaagtttgtgcgatcaggtaaatcaaaaggagataaaggagagaaatcaaaggagagt
aaacgtaaaaacagcaaagagagcaacagctcatcatccctcaataaggcagatacactc
actcataaatcagctcctagttgggctgatagatgcgattccccgcctaacattgagtca
agtttatcacctttccagactgtaaccactacttataataccccgcctacctcctctact
catcgtacaactactccaagtgttgttccttcctctgctccccctgagacagggtctctc
tctttctctccgtcactcccccagctgtatcagtatggtcttcatactcctttatatcca
atctcttataccccaacgcattttgatactccgtcacctaaacccactccattgggtagt
cgtacaccagggacgcctacaacagaggctgagcattttaagaaatggttgaagtgccat
agacttcataaatatgataatttatttaccaacatgagctttgaagaggtcacaaagtta
acagtggaaaatttaaagagcattggaatgacacagggagctgcaaagaaactctcacaa
aaattaaatgagcaactaataaatggtgcaacgtcatttcgtgacatgccaataccagcc
atatcacgacgcccatcaaccactagccttcctgctgctcttttgttagagaggcaacag
ttaactccctcatcatctatcgaccagctcagtctgcatggtggcagtacttgcagtctt
gatgtacttggtcatagttactctcaccacagcacacccaaacatcttcaccgccatagt
gacagcatttcagatgccaatacagttgatactgccattttagaggctggaccttcttct
aatgtttacaccagaggaggtaatgagattgatggctctagagggaatactgtcaatgga
cagtctagattatcttacacttcatcctctcctcttcattgggctcctactccctatgta
gtcactacgcctacagataaagacacagagttaaaagatgaatttaacagaccaacatat
tcacataagaaagaatcagatcatcaaccacgtctgccccatcgtcttgtacctcaggga
actaccaatagaatgcaagggattgtagcatcaaactggcctcatcctttacctgctcct
cctcctactgtaccgccacaaatggtccgtggtgtccacagaaacagtcaacctgttttg
acgtacactcagacagtaaatggactagttcgctcttcaccagttttgcatgctggttct
ggtcctcctagtaatagatactccgctcctccgatccagcaatccttagctactcctcaa
atttattattcttcttcctctcggtctcccggcccatctccctcatcttcctattcttgt
tataattgtggcaatagaggacaccaaggagttacctgtcctttactctatacctctcct
ccttcatcctcatccaataatagtgcgctattgagaagttga

DBGET integrated database retrieval system