KEGG   Agrobacterium radiobacter: Arad_0138Help
Entry
Arad_0138         CDS       T00850                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00250  Alanine, aspartate and glutamate metabolism
ara00410  beta-Alanine metabolism
ara00640  Propanoate metabolism
ara00650  Butanoate metabolism
ara01100  Metabolic pathways
ara01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Arad_0138 (gabT)
   00650 Butanoate metabolism
    Arad_0138 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Arad_0138 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Arad_0138 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ara01007]
    Arad_0138 (gabT)
Enzymes [BR:ara01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Arad_0138 (gabT)
Amino acid related enzymes [BR:ara01007]
 Aminotransferase (transaminase)
  Class III
   Arad_0138 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACM24905
UniProt: B9JGQ9
LinkDB All DBs
Position
1:complement(131413..132684)
Genome map
AA seq 423 aa AA seqDB search
MTLTDRKNAAISRGVGMTTQIYADRAENSEIWDKEGRRYIDFASGIAVVNTGHRHPRVIA
AVKEQLDRFTHTCHQVVPYENYVHLAERLNALTPGDFAKKTIFVTTGAEAVENAIKIARA
ATGRSAVIAFGGGFHGRTFMGMALTGKVVPYKVGFGSMPGDVFHAPFPVPLHGVTVEQSL
AALKKLFAADVDPQRVAAIIIEPVQGEGGFYSAPASFMKALRELCDQHGILLIADEVQTG
FARTGKMFAMDHHEVAPDLMTMAKSLAGGFPLAAVTGRAEIMDAPGPGGLGGTYGGNPIG
IAAAHAVLDVIVEEDLCNRANQLGSRLKQRLESLRDKVPEIVDIRGPGFMNAIEFNDATT
KLPSADFANKVRLIALDKGLILLTCGVHGNVIRFLSPITIQDGVFSEALDILEASMLEAS
AGK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgacagaccggaagaacgccgccatttcccgcggcgttggcatgaccacgcag
atctatgccgaccgggctgaaaattcggagatctgggacaaggaagggcgccgctacatc
gactttgcctccggcatcgccgtcgtcaacaccggccatcgccatccccgcgtcatcgcc
gccgtcaaggagcagctcgaccgcttcacccacacctgccatcaggtcgtgccctatgaa
aactatgtgcatcttgccgagcgcctcaacgccctgacgccgggcgatttcgccaagaag
accatcttcgtcaccaccggcgccgaagcggtcgagaatgccatcaagatcgcccgcgcc
gccaccggccgttcggccgtcatcgcctttggcggcggcttccatggccgcaccttcatg
ggcatggcgctgaccggcaaggtcgtgccctacaaggtcggtttcggctcgatgccgggc
gacgtcttccatgcgcccttcccggtgccgctgcacggcgttaccgtcgagcagtcactc
gccgcactgaaaaagctgtttgccgccgatgtcgacccgcagcgtgttgccgccatcatc
atcgagccggtgcagggcgaaggcggtttttactcggcgcccgcctccttcatgaaggca
cttcgggaactttgcgaccagcacggcattctgctcattgccgatgaagtacagaccggc
tttgcccgtaccggcaagatgttcgccatggaccatcacgaggtcgcacctgatctcatg
acgatggcaaagagccttgccggcggcttcccgctggccgccgtcaccggccgggccgaa
atcatggatgcgccgggaccgggtggcctcggcggcacctatggcggcaatccgatcggc
atcgccgccgctcatgccgtgctcgatgtcatcgtcgaagaggacctctgcaaccgcgcc
aaccagctcggttcgcgactgaaacaacggctggaatcgctgcgcgacaaggtgccggag
atcgtcgacattcgcggaccaggcttcatgaacgccattgagttcaacgatgcgacgacg
aaactgccgagcgccgacttcgccaataaggtacggctgatcgccctcgacaagggcctg
atcctgctcacctgcggcgtccacggcaatgtcatccgcttcctctcgccgatcaccatt
caggacggcgtattcagcgaggcgctcgacattctggaagcctcgatgctggaagcaagc
gccggcaaataa

DBGET integrated database retrieval system