KEGG   Agrobacterium radiobacter: Arad_0161Help
Entry
Arad_0161         CDS       T00850                                 

Gene name
fabI1
Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase (NADH) protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00061  Fatty acid biosynthesis
ara00780  Biotin metabolism
ara01100  Metabolic pathways
ara01130  Biosynthesis of antibiotics
ara01212  Fatty acid metabolism
Module
ara_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Arad_0161 (fabI1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Arad_0161 (fabI1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Arad_0161 (fabI1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ara01004]
    Arad_0161 (fabI1)
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Arad_0161 (fabI1)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Arad_0161 (fabI1)
Lipid biosynthesis proteins [BR:ara01004]
 Fatty acid synthase
  Component type
   Arad_0161 (fabI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF2463
Motif
Other DBs
NCBI-ProteinID: ACM24921
UniProt: B9JGS5
LinkDB All DBs
Position
1:147674..148480
Genome map
AA seq 268 aa AA seqDB search
MTGIMQGKRGLIMGVANNHSIAWGISKALAAEGAELAFTFQGEALGKRVKPLAAEVGSDF
LLPCDVEDLASVDAVFDEIKARWGKLDFIVHAIGFSDKNELKGLYANTTRDNFTRTMVIS
CFSFTEIAKRAADLMADGGSMLTLTYNGSTRVIPNYNVMGVAKAALEASVRYLAADYGPR
GIRVNAISAGPIRTLAGAGISDARAILSWNQRNAPLRKSVTIDQVGSSSLYLLSGLSAGV
TGEIHFVDAGYNITSMPTLEALASADAE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaatcatgcagggtaagcgcggcctcatcatgggcgtcgcaaacaatcactcg
attgcctggggcatttcgaaggcgctcgccgccgaaggcgcggaactggcattcaccttc
cagggcgaagcgctcggcaagcgcgtcaagccgctcgccgccgaagtcggctcggatttc
cttctgccctgcgacgtcgaggatctggcctccgtcgacgccgtgttcgacgagatcaag
gcgcgctggggcaagctggacttcatcgtccacgccatcggcttttccgacaagaacgag
ctgaagggcctctacgccaacaccacgcgcgacaacttcacccgcacgatggtgatttcc
tgtttctccttcaccgagattgccaagcgcgccgccgacctgatggcggacggcggcagc
atgctgacgctgacctataacggctcgacgcgggtgatcccgaattacaacgtcatgggc
gtcgccaaggcggctctggaagcctccgtgcgctacctcgccgccgattacggcccgcgc
ggcatccgcgtcaacgccatttccgccggcccgatccgcacgctggccggcgccggcatt
tccgacgcccgcgccatcctgtcgtggaaccagcgcaatgcgccgctgcgcaagtctgtg
accatcgaccaggtcggctcgtcgtcgctctatctgctctccggcctgtcggcaggcgtc
accggcgaaatccacttcgtcgatgccggctacaacatcacctcgatgccgacgctggaa
gcattggccagcgctgacgcagagtaa

DBGET integrated database retrieval system