KEGG   Agrobacterium radiobacter: Arad_12135Help
Entry
Arad_12135        CDS       T00850                                 

Definition
(GenBank) xylitol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00040  Pentose and glucuronate interconversions
ara01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Arad_12135
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Arad_12135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Pyr_redox Arteri_nsp7a
Motif
Other DBs
NCBI-ProteinID: ACM31186
UniProt: B9JPW7
LinkDB All DBs
Position
pAtK84c:complement(97980..99026)
Genome map
AA seq 348 aa AA seqDB search
MTTQRALVLERQHELKLRDIDLPQEVGPGEVKIKIHTVGVCGSDVHYYTHGRIGPFVVNA
PMVLGHEAAGTVAEVGAGVSHLKVGDRVCMEPGIPDANSKASRLGMYNVDPAVTFWATPP
IHGVLTPFVVHPANYTFKLPDNVSFAEGAMVEPFAVGMQAAAKAKITPGDTAVVLGAGPI
GTMVAIAALAGGCARAIVADLAQPKLDIAAQYQGVIPVNIREKNLIEEVRRLTDGWGADV
VFECSGSPKAWETVMELPRPGGVIVAVGLPVAPVGFDVSTASTKEVRIETVFRYAHQYER
SIALIASGRVDLKPLISETFTFEQSIEAFDRAVEARPSDVKLQITFEG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcaacgcgcattggttctcgaacgccaacatgaactgaagcttcgtgacatc
gacctgccacaggaggtcggaccaggtgaggtgaagatcaagatccatacggtcggcgtc
tgcggatcggatgtgcattattacacccatggccgcatcggcccgttcgttgtcaatgcg
ccgatggtgcttggtcatgaggcggccggcacggtggccgaagtcggtgccggtgtttct
catctgaaggtcggcgaccgcgtctgcatggagcccggcattcccgatgccaattcgaag
gcgagccgcctcggcatgtacaatgtcgatcccgccgtcaccttctgggcgacgccgccg
atccatggcgtgctgacgccctttgtcgtgcacccggccaattataccttcaagcttccg
gacaatgtcagctttgcggagggtgcgatggtcgagcctttcgcggtcggcatgcaggcg
gcggccaaggcgaagattacacccggcgataccgccgtcgtgctcggcgcagggccgatc
ggcaccatggtcgccatcgcagccctcgccggcggctgcgcccgtgctatcgtcgccgat
ctcgcccagccgaagctcgatatcgctgcgcagtatcagggcgtgatccccgtcaacatc
cgcgagaagaacctgatcgaggaggtcaggcgcctgaccgacggttggggcgcggatgtc
gtcttcgaatgctccggttcgccgaaggcttgggagaccgtgatggagctgccgcgtccg
ggcggcgttatcgtcgccgtcggcctgccggtcgccccggtcggctttgatgtctcgacc
gcctcgacgaaggaagtccgcatcgaaacggtcttccgctacgcccatcaatatgagcgc
tcgattgcgctgatcgcctccggccgggtcgacctgaagccgctgatctcggagacgttt
acattcgagcaatcgatcgaagccttcgatcgagccgtggaagcacggccgagcgacgtc
aagctgcagattacgtttgaaggctga

DBGET integrated database retrieval system