KEGG   Agrobacterium radiobacter: Arad_1428Help
Entry
Arad_1428         CDS       T00850                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ara  Agrobacterium radiobacter
Brite
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Arad_1428 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACM25866
UniProt: B9JBG0
LinkDB All DBs
Position
1:1139866..1140468
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYDALSPFMSRETLEYHHDKHHKAYVDNGNKLAAEAGLSDLSLEEIVKKS
FGTNAGLFNNAAQHYNHVHFWKWMKKGGGGNKLPGKLEAAFASDLGGYDKFKADFAAAGA
TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNLRPKYLEA
FIDSLINWDYVLERYEAATK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgcctgaacttccctacgattacgatgctctttcccccttcatgtcg
cgtgagactctcgagtatcaccacgacaagcatcacaaggcctatgtcgacaacggcaac
aagctcgctgctgaagcaggcctgtccgatctctcgctcgaagagatcgtgaagaagtcc
ttcggcaccaatgccggcctcttcaacaatgctgcccagcattacaaccacgtccatttc
tggaagtggatgaagaagggcggcggcggcaacaagctgccaggcaagctcgaagctgcc
ttcgcttccgatctcggcggctatgacaagttcaaggccgatttcgctgctgccggcgcc
acccagttcggctccggctgggcctgggtttccgtcaagaacggcaagctcgaaatctcc
aagaccccgaacggcgaaaacccgctggttcatggtgcgaccccgatcctcggcgtcgac
gtctgggaacactcctactacatcgactaccgcaacctgcgcccgaagtacctcgaggcc
ttcatcgatagcctgatcaattgggactacgtcctggagcgctacgaagccgccacgaag
taa

DBGET integrated database retrieval system