KEGG   Agrobacterium radiobacter: Arad_1718Help
Entry
Arad_1718         CDS       T00850                                 

Gene name
gstch7
Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Arad_1718 (gstch7)
Enzymes [BR:ara01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Arad_1718 (gstch7)
Transporters [BR:ara02000]
 Other Transporters
  Pores ion channels [TC:1]
   Arad_1718 (gstch7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ACM26081
UniProt: B9JCU4
LinkDB All DBs
Position
1:complement(1359153..1359749)
Genome map
AA seq 198 aa AA seqDB search
MRLLCSSTSPFSSKVRMAARHLGIELNEIRVDTNAGPNVLVDNNPLGKIPTLLTDDGEAI
FDSRSIMHYFHRMKGKTLYPAKDGKRTEVEVLEALCDGTAECLLSIVYERRLRDSDKQHQ
PWIDRQWTKVGRALTHLNAEPPKIGKKLHGGHFALAALLGYLQLRFEGEWEADHADLIAW
ARKFEKHFPDYQAMKPQG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttctctgctcgtccacctctcctttttccagcaaggtgcggatggccgcccgg
catctcggcatcgagctcaacgaaatccgcgtcgataccaatgccgggccgaacgtgctg
gtcgacaacaatccgctcggcaagatcccgacgctgctgacggatgacggcgaagcgatc
ttcgacagccgctccatcatgcattatttccaccggatgaagggcaagacgctttatccc
gccaaggatggcaagcgcaccgaagtcgaggtgctggaagcgctttgcgacggtaccgcc
gaatgcctgctgtcgatcgtttacgaacgccggctgcgcgattcggacaagcagcatcag
ccctggatcgaccgccagtggacaaaggtcggccgcgccctcacccatctcaatgccgag
ccgccgaagatcggcaagaagctgcatggcggacactttgccctggccgccctgctcggc
tacctgcagctgcggttcgaaggagaatgggaagcagatcatgccgacctgatcgcctgg
gcgcgcaagttcgaaaagcattttcccgactatcaggcgatgaagccgcagggctga

DBGET integrated database retrieval system