KEGG   Agrobacterium radiobacter: Arad_2231Help
Entry
Arad_2231         CDS       T00850                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00061  Fatty acid biosynthesis
ara00780  Biotin metabolism
ara01100  Metabolic pathways
ara01212  Fatty acid metabolism
Module
ara_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Arad_2231 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Arad_2231 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ara01004]
    Arad_2231 (fabZ)
Enzymes [BR:ara01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Arad_2231 (fabZ)
Lipid biosynthesis proteins [BR:ara01004]
 Fatty acid synthase
  Component type
   Arad_2231 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: ACM26470
UniProt: B9JEX9
LinkDB All DBs
Position
1:1761891..1762364
Genome map
AA seq 157 aa AA seqDB search
MTEDAKTSLSSADIIEIMKLLPHRYPFLMVDRIIEIDSDNSAIGIKNVTANEPQFTGHFP
GSPIMPGVLLIEGMAQTAGAICARKDGIGGNLVYFMTIDNARFRKPVVPGDRVEFHVVKQ
KQRGTIWKFHCDAKVDGSVVAEADIGAMIVRKDPDQA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgccaagacgtcgctgtcgtcggctgatatcatcgagattatgaagctg
ttgccgcatcgctatccgttcctgatggtcgacaggatcatcgagatcgatagcgacaac
tccgctatcggtatcaagaacgtcacggccaacgagccgcaattcactgggcactttccg
ggctcgccgattatgccgggtgttttgttgatcgaaggcatggcgcagacggcaggtgcg
atctgcgctcgcaaggatggtattggcggcaacctcgtctacttcatgacgatcgacaat
gctcgcttccgcaagccggtcgttcctggcgaccgggtggaattccatgtcgtcaagcaa
aagcagcgcggcacgatctggaagttccactgcgatgccaaggtcgatggttcggtggtt
gccgaggccgatatcggtgcgatgattgtacggaaggacccggatcaggcatga

DBGET integrated database retrieval system