KEGG   Agrobacterium radiobacter: Arad_2858Help
Entry
Arad_2858         CDS       T00850                                 

Gene name
afuA3
Definition
(GenBank) iron(III) ABC transporter
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
ara  Agrobacterium radiobacter
Pathway
ara02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ara00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Arad_2858 (afuA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ara02000]
    Arad_2858 (afuA3)
Transporters [BR:ara02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    Arad_2858 (afuA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: ACM26943
UniProt: B9JGG8
LinkDB All DBs
Position
1:complement(2266361..2267341)
Genome map
AA seq 326 aa AA seqDB search
MKTLVSAFAGLLAVALFSGSAAAADLVLYTSQPNADAQATVDGFMAANPGIKVDWVRDGT
PQIIAKLQAEIQAGAPVADVLLIADTVTLERLKEAGKLLAYKSPEAANYDAALYDADGYY
YSTKLITTGIVYNTAASMKPTSWQDLTKPEAKGLVAMPSPLASGAALIHAQTLAGVGSLG
WDFYKNLAANGAVAAGGNGAVLKSVASGEKAYGMVVDYMPIREKAKGAPLEFVFPSEGVS
AVTEPVGILASAKHADAAKKFVDYVLSEKGQEGFLKLGYIPARNGMSLPASFPARDSIKV
LPLNAAEALKNTDQDLKTFSSYYGLN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgcttgtttccgctttcgccggcctcctggccgttgctcttttctccggctcg
gctgcggccgccgacctcgtcctatataccagccagccgaatgccgatgcgcaggcaacc
gtcgatggtttcatggccgccaatcccggcatcaaggtcgattgggtccgcgacggcacg
ccgcagatcatcgccaagctgcaagcggaaatccaggccggcgctccggtcgccgatgtt
ctcctgatcgccgatacggtcacgctggaacgcctgaaagaagccggcaagctgctggcc
tataagtcgccggaagctgcgaattacgacgcggctctctatgacgccgatggctattat
tattccaccaagctgatcaccaccggcatcgtctacaacaccgccgcttcgatgaagccg
acgagctggcaggatctgaccaagccggaagccaagggtctggttgccatgccaagcccg
cttgcttcgggcgctgcgctcattcatgcgcagacgctcgctggcgtcggcagcctcggc
tgggatttctacaagaaccttgccgccaatggcgcagttgctgctggtggcaacggcgcg
gtgctgaagtcggtcgcctcgggcgagaaagcctatggcatggtcgtcgactacatgccg
atccgcgaaaaggccaagggcgcaccgctggaattcgtgttcccgtccgaaggtgtttcg
gcggtgaccgagccggtcggcattctcgccagcgccaagcatgccgacgccgccaagaag
ttcgtcgattatgttctttccgaaaaaggccaggagggcttcctcaagctcggctatatt
ccggcccgcaacggcatgtcgctgcctgccagtttcccggcgcgtgacagcatcaaggtt
ttgccgttgaatgctgccgaagccctgaagaataccgatcaggacctgaagaccttctcc
tcctattacggattgaattga

DBGET integrated database retrieval system