KEGG   Agrobacterium radiobacter: Arad_3270Help
Entry
Arad_3270         CDS       T00850                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00240  Pyrimidine metabolism
ara01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Arad_3270 (tdk)
Enzymes [BR:ara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Arad_3270 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ACM27264
UniProt: B9J7U3
LinkDB All DBs
Position
1:complement(2606862..2607443)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFHYSTMNAGKSTMLLQAAYNYQERGMRTAAFIAALDDRAGRGKIASRIGLTMDAI
PFDAADDLFTLVDEMHAEEPLACVFVDEAQFLSHEQVWQLAHVVDRLDLPVMAYGLRTDF
HGKLFPGSQELLTIADELREVRTICHCGRKATMVVRLDSAGKAARDGAQIEIGGSDKYVS
LCRRHWEAAMAEE
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttccattattcgacgatgaatgccggcaagtcgaccatgttgttg
caggcggcctacaattatcaggagcgcggcatgcgtaccgcggcttttattgctgcgctg
gacgatcgcgccggtcgcggcaagattgcgtcgcgtattggcctgacgatggatgccata
ccgttcgatgccgccgacgatctcttcaccttggtcgatgaaatgcatgccgaggagcct
ctggcctgcgtctttgtcgatgaggcgcaattcctgtcgcatgagcaggtctggcagctt
gctcatgtcgtcgatcgccttgacctgccggtcatggcctacggactgcggacggatttc
catgggaagttatttccgggctcgcaggagctgctgacgatcgccgacgagttgcgcgaa
gtgcggacgatctgccattgcgggcgcaaggcgaccatggtggtgcgcctcgattcggcc
ggcaaggcggcgcgcgacggcgcgcagatcgagatcggcggcagcgacaaatatgtttcg
ctttgccgccgccactgggaagcggcgatggcggaagaatag

DBGET integrated database retrieval system