KEGG   Agrobacterium radiobacter: Arad_4294Help
Entry
Arad_4294         CDS       T00850                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00564  Glycerophospholipid metabolism
ara01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ara00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Arad_4294 (glpD)
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Arad_4294 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2 FAD_oxidored AlaDh_PNT_C STPPase_N
Motif
Other DBs
NCBI-ProteinID: ACM28032
UniProt: B9JBY6
LinkDB All DBs
Position
1:3431028..3432593
Genome map
AA seq 521 aa AA seqDB search
MIFELSIFQDGGGFAEGRVSEQIHDIFVIGGGINGCGIARDAVGRGYKVALAEMNDFASG
TSSGATKLIHGGLRYLEHYEFRLVRESLMEREVLWAMAPHIIWPMRFVLPYHKGGIRPAW
LIRLGLFLYDHLGGRKLLPPTATLDMKTDPAGKPLKSLFTKAFEYSDGWVDDARMVVLNA
RDAADRGATIMPRTKVISARRDGALWTIETEDTVTGEKRLFKSRMLINAAGPWVDHVLSD
AFGTNQAHNVRLVQGSHIVVRKKFNDPRAYFFQNPDNRIIFAIPYEQDFTLIGTTDRDYK
DDPKDVRISEEETTYLCNAASEYFKEPVRPEDIVWTYSAVRPLYDDGATKAQEATRDYVL
KVEGAEGQAPLLNVFGGKLTTYRRLSEHALEKIGEAIGLKGTPWTAKSSLPGGDFPAKGY
EAEVVKLKARYPFLTDPHARRLVRRYGTRATMILGDAKTIADLGRSFGSDLYEAEVRYLM
AHEWAYTAADVLWRRSKKGLYLSKDQAAALDDYMAGTRVHA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
ttgattttcgaattatccatcttccaagatggcgggggctttgcggaggggcgcgtgagc
gagcagatccacgacattttcgtcattggcggcggcatcaacggctgcggcatcgcccgt
gacgccgtcgggcgcggctacaaggtcgcgcttgccgaaatgaacgatttcgcctccggc
acatcgtccggcgccaccaagctgatccatggcggcctgcgctatctcgaacattacgaa
ttccgcctggtgcgcgaatcgctgatggagcgcgaagtgctctgggcgatggcgccgcac
atcatctggccgatgcgtttcgtcctgccctatcacaagggcggcatccgtccggcctgg
ctcatccgcctcggccttttcctttacgaccatcttggcggtcgcaagctgctgccgccg
acggcgacgctcgacatgaagaccgacccggcaggtaagccgctgaagtcgctgttcacc
aaggcattcgaatattccgacggctgggtggatgacgcccgcatggtcgtgctcaacgcc
cgcgacgccgccgatcgcggcgccacgatcatgccgcgcaccaaggtcatatcggcccgc
cgtgacggcgccctctggacgatcgaaactgaggacaccgtcaccggcgagaagcgcctc
ttcaagtcgcgcatgctgatcaatgccgccggcccgtgggtcgatcatgtcctctccgac
gcgtttggcaccaaccaggcccacaatgtccgcctggtgcagggcagccacatcgtcgtc
cgcaaaaaattcaacgatccgcgcgcctatttcttccagaatccggataatcgcatcatc
ttcgccattccctacgaacaggacttcaccctgatcggcaccacggaccgcgactataag
gacgatccgaaggatgtgaggatttccgaagaggaaaccacctatctctgcaacgccgcc
agcgaatatttcaaggagccggttcgccccgaggatatcgtctggacctattccgccgtg
cgcccgctctatgacgacggcgccaccaaggcgcaggaagcgacccgcgactacgtgctg
aaggtcgagggcgcggaaggtcaggcaccgctgctcaacgtcttcggcggcaagctcacc
acctatcgtcgcctgagcgaacatgcgctggaaaagatcggcgaagccatcggcctcaag
ggcacgccatggacggccaagagctccctacccggcggcgatttcccggccaagggttac
gaagccgaagtggtcaagctgaaggcgcgttatcccttcctcaccgacccgcacgcccgc
cggctggtgcgccgctacggcacccgcgccaccatgatcctcggagacgcaaagaccatc
gccgatctcggccgcagcttcggcagcgatctctacgaggcggaagtgcgctatctgatg
gcacatgaatgggcctataccgccgccgatgtcctctggcgccgttcgaagaaggggctc
tacctctcgaaggaccaggccgctgcgctggacgactatatggccggcacgcgggtccac
gcataa

DBGET integrated database retrieval system