KEGG   Agrobacterium radiobacter: Arad_8449Help
Entry
Arad_8449         CDS       T00850                                 

Definition
(GenBank) ferredoxin reductase protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ara  Agrobacterium radiobacter
Brite
KEGG Orthology (KO) [BR:ara00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Arad_8449
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Arad_8449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 FAD_binding_3 DAO Thi4 NAD_binding_7 NAD_binding_8 AlaDh_PNT_C K_oxygenase Glutaredoxin Spermine_synth DUF2597 FMO-like
Motif
Other DBs
NCBI-ProteinID: ACM29722
UniProt: B9JII0
LinkDB All DBs
Position
2:complement(1270578..1272158)
Genome map
AA seq 526 aa AA seqDB search
MLDDALKSQLKAYLEKVVRPIEILANVDDSAKSKEMVALLEDIAGLSDKITFAQQRDASE
RAPSFALTSPGHDISLRFAGIPLGHEFTSLVLALLQTGGHPPRVEQAILDQIRDLDGQFR
FETYFSLSCQNCPDVVQALNLMSILNPKISHVAVDGAVFPQEVADRQVMSVPTVYLNGEV
FGQGRMEVEQIIAKLDTGAAKRAAEKLADLEPFDVLVVGGGPAGAASAIYAARKGIRTGV
VAERFGGQVLDTMAIENFISVPHTEGPAFASALEAHVKDYPVEIMNLQRAEKLTPRGDLF
EVELASGATLKSRTLILSTGARWRQMGVPGEEQYRNKGVAYCPHCDGPLFKGKDVAVIGG
GNSGVEAAIDLAGIVKHVTLIEFDSKLRADDVLQRKLRSLSNVRIILSAKSTEVLGDDSK
VTGLVYEDRNKDEKHTLTLDGIFVQIGLLPNTEWLKGTITLSPRGEIVVDHHGQTSLPGV
FAAGDCTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPSEEEAKAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgctagacgacgcactgaaaagccagctcaaggcctatctggaaaaagtcgtacggccg
atagagatcctcgcgaatgtcgatgacagtgccaaatcgaaggagatggtggcgcttctc
gaagacattgccggcctctccgacaagatcaccttcgcccagcagcgtgacgccagcgaa
cgggccccctcattcgccctgaccagcccgggccacgatatcagcctgcgtttcgccggc
attccgctcggccacgaattcacttcgctcgtgctcgcccttttacagaccggcggacat
ccgccccgcgtcgagcaggccattctcgaccagatccgcgatcttgacggacaattccgt
ttcgaaacctatttctcactgtcgtgccagaattgccctgacgtcgtgcaggcgctcaac
ctgatgtcgattctcaatccgaagatcagccatgtcgccgtcgacggcgccgtgttcccg
caggaagttgcggatcggcaggtcatgtcggttcccacggtctatctgaatggcgaagtg
ttcggccagggccgcatggaagtcgagcagatcatcgccaagctcgacacaggcgctgca
aagcgcgccgccgagaagctcgcagatctcgagcccttcgacgtgctggtggtcggcggc
ggtccggctggcgctgcctcggcgatctatgccgcccgcaagggtatccgcaccggtgtt
gtggccgaacgctttggcggccaggtgctcgataccatggcgatcgagaatttcatttcg
gtcccgcacaccgaaggcccggccttcgcgagcgcccttgaggcgcatgtgaaggactat
cccgtcgagatcatgaacctgcagcgggctgaaaagctgacgcccaggggcgacctgttc
gaggtcgagcttgccagcggcgcgacgctgaaatcgcgcacgctgatcctgtccaccggc
gcgcgctggcggcagatgggcgtgcccggcgaggagcaatatcgcaacaagggtgtcgcc
tattgcccgcattgcgatggcccgctgttcaagggtaaggatgtggccgtgatcggcggc
ggcaattccggcgtcgaggcggcgatcgatcttgccggtatcgtcaagcacgtcaccctc
atcgaattcgacagcaagctgcgcgcagacgacgtcttgcagcgcaagctgcgcagcctt
tccaacgtccggatcattctgtcggccaagagcacggaagtgctgggcgacgacagcaag
gtcaccggtcttgtctacgaggaccgcaacaaggacgagaagcacacgctgacgctcgac
ggcattttcgtgcagatcggccttctgcccaatacggaatggctgaagggcaccatcacg
ctttctccccgcggcgagattgtcgtcgatcatcacggccagacgtcgctgcccggcgtc
tttgccgccggcgattgcaccaccgttccctacaagcagatcgttatcgccgtgggcgaa
ggcgccaaggcgtcgcttgccgctttcgaccatctcatccgcacctctgctccgagcgaa
gaggaagccaaggccgcctaa

DBGET integrated database retrieval system